From nobody Tue Feb 10 22:15:56 2026 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 9DB53C001E0 for ; Fri, 28 Jul 2023 10:03:35 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S235684AbjG1KDA (ORCPT ); Fri, 28 Jul 2023 06:03:00 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:37194 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S233106AbjG1KC3 (ORCPT ); Fri, 28 Jul 2023 06:02:29 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 2924049C4; Fri, 28 Jul 2023 03:01:58 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 392725c6ea6dcf7f; Fri, 28 Jul 2023 12:01:56 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 29317661E37; Fri, 28 Jul 2023 12:01:56 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Peter Zijlstra , Anna-Maria Behnsen , Frederic Weisbecker , Kajetan Puchalski Subject: [PATCH v2 3/3] cpuidle: teo: Drop utilized from struct teo_cpu Date: Fri, 28 Jul 2023 12:01:49 +0200 Message-ID: <8262074.T7Z3S40VBb@kreacher> In-Reply-To: <5707588.DvuYhMxLoT@kreacher> References: <5707588.DvuYhMxLoT@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrieeigddvtdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepphgvthgvrhiisehinhhfrhgruggvrggurdhorhhgpdhrtghpthhtoheprghnnhgrqdhmrghrihgrsehlihhnuhhtrhhonhhigidruggvpdhrtghpthhtohepfhhrvggu vghrihgtsehkvghrnhgvlhdrohhrghdprhgtphhtthhopehkrghjvghtrghnrdhpuhgthhgrlhhskhhisegrrhhmrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki Because the utilized field in struct teo_cpu is only used locally in teo_select(), replace it with a local variable in that function. No intentional functional impact. Signed-off-by: Rafael J. Wysocki --- drivers/cpuidle/governors/teo.c | 9 ++++----- 1 file changed, 4 insertions(+), 5 deletions(-) Index: linux-pm/drivers/cpuidle/governors/teo.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/cpuidle/governors/teo.c +++ linux-pm/drivers/cpuidle/governors/teo.c @@ -187,7 +187,6 @@ struct teo_bin { * @next_recent_idx: Index of the next @recent_idx entry to update. * @recent_idx: Indices of bins corresponding to recent "intercepts". * @util_threshold: Threshold above which the CPU is considered utilized - * @utilized: Whether the last sleep on the CPU happened while utilized */ struct teo_cpu { s64 time_span_ns; @@ -197,7 +196,6 @@ struct teo_cpu { int next_recent_idx; int recent_idx[NR_RECENT]; unsigned long util_threshold; - bool utilized; }; =20 static DEFINE_PER_CPU(struct teo_cpu, teo_cpus); @@ -366,6 +364,7 @@ static int teo_select(struct cpuidle_dri int idx0 =3D 0, idx =3D -1; bool alt_intercepts, alt_recent; ktime_t delta_tick; + bool cpu_utilized; s64 duration_ns; int i; =20 @@ -390,13 +389,13 @@ static int teo_select(struct cpuidle_dri goto end; } =20 - cpu_data->utilized =3D teo_cpu_is_utilized(dev->cpu, cpu_data); + cpu_utilized =3D teo_cpu_is_utilized(dev->cpu, cpu_data); /* * If the CPU is being utilized over the threshold and there are only 2 * states to choose from, the metrics need not be considered, so choose * the shallowest non-polling state and exit. */ - if (drv->state_count < 3 && cpu_data->utilized) { + if (drv->state_count < 3 && cpu_utilized) { /* The CPU is utilized, so assume a short idle duration. */ duration_ns =3D teo_middle_of_bin(0, drv); /* @@ -558,7 +557,7 @@ static int teo_select(struct cpuidle_dri * been stopped already and the shallower state's target residency is * not sufficiently large. */ - if (cpu_data->utilized) { + if (cpu_utilized) { s64 span_ns; =20 i =3D teo_find_shallower_state(drv, dev, idx, duration_ns, true);