From nobody Sun Feb 8 02:53:40 2026 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id B2DC047776; Wed, 27 Dec 2023 20:41:46 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=rjwysocki.net Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.4.0) id bd786dfcd3488790; Wed, 27 Dec 2023 21:41:44 +0100 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by cloudserver094114.home.pl (Postfix) with ESMTPSA id E462F668E17; Wed, 27 Dec 2023 21:41:43 +0100 (CET) From: "Rafael J. Wysocki" To: Greg KH , linux-pm@vger.kernel.org Cc: Youngmin Nam , rafael@kernel.org, linux-kernel@vger.kernel.org, d7271.choe@samsung.com, janghyuck.kim@samsung.com, hyesoo.yu@samsung.com, Alan Stern , Ulf Hansson Subject: [PATCH v1 1/3] async: Split async_schedule_node_domain() Date: Wed, 27 Dec 2023 21:37:02 +0100 Message-ID: <4551962.LvFx2qVVIh@kreacher> In-Reply-To: <6019796.lOV4Wx5bFT@kreacher> References: <5754861.DvuYhMxLoT@kreacher> <6019796.lOV4Wx5bFT@kreacher> Precedence: bulk X-Mailing-List: linux-kernel@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvkedrvddvledgudegudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopedutddprhgtphhtthhopehgrhgvghhkhheslhhinhhugihfohhunhgurghtihhonhdrohhrghdprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopeihohhunhhgmhhinhdrnhgrmhesshgrmhhsuhhnghdrtghomhdprhgtphhtthhopehrrghfrggvlheskhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepugejvdejuddrtghhohgvsehsrghmshhunhhgrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=10 Fuz1=10 Fuz2=10 Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki In preparation for subsequent changes, split async_schedule_node_domain() in two pieces so as to allow the bottom part of it to be called from a somewhat different code path. No functional impact. Signed-off-by: Rafael J. Wysocki Tested-by: Youngmin Nam --- kernel/async.c | 56 ++++++++++++++++++++++++++++++++++------------------= ---- 1 file changed, 34 insertions(+), 22 deletions(-) Index: linux-pm/kernel/async.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/kernel/async.c +++ linux-pm/kernel/async.c @@ -145,6 +145,39 @@ static void async_run_entry_fn(struct wo wake_up(&async_done); } =20 +static async_cookie_t __async_schedule_node_domain(async_func_t func, + void *data, int node, + struct async_domain *domain, + struct async_entry *entry) +{ + async_cookie_t newcookie; + unsigned long flags; + + INIT_LIST_HEAD(&entry->domain_list); + INIT_LIST_HEAD(&entry->global_list); + INIT_WORK(&entry->work, async_run_entry_fn); + entry->func =3D func; + entry->data =3D data; + entry->domain =3D domain; + + spin_lock_irqsave(&async_lock, flags); + + /* allocate cookie and queue */ + newcookie =3D entry->cookie =3D next_cookie++; + + list_add_tail(&entry->domain_list, &domain->pending); + if (domain->registered) + list_add_tail(&entry->global_list, &async_global_pending); + + atomic_inc(&entry_count); + spin_unlock_irqrestore(&async_lock, flags); + + /* schedule for execution */ + queue_work_node(node, system_unbound_wq, &entry->work); + + return newcookie; +} + /** * async_schedule_node_domain - NUMA specific version of async_schedule_do= main * @func: function to execute asynchronously @@ -186,29 +219,8 @@ async_cookie_t async_schedule_node_domai func(data, newcookie); return newcookie; } - INIT_LIST_HEAD(&entry->domain_list); - INIT_LIST_HEAD(&entry->global_list); - INIT_WORK(&entry->work, async_run_entry_fn); - entry->func =3D func; - entry->data =3D data; - entry->domain =3D domain; - - spin_lock_irqsave(&async_lock, flags); =20 - /* allocate cookie and queue */ - newcookie =3D entry->cookie =3D next_cookie++; - - list_add_tail(&entry->domain_list, &domain->pending); - if (domain->registered) - list_add_tail(&entry->global_list, &async_global_pending); - - atomic_inc(&entry_count); - spin_unlock_irqrestore(&async_lock, flags); - - /* schedule for execution */ - queue_work_node(node, system_unbound_wq, &entry->work); - - return newcookie; + return __async_schedule_node_domain(func, data, node, domain, entry); } EXPORT_SYMBOL_GPL(async_schedule_node_domain); From nobody Sun Feb 8 02:53:40 2026 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id B56F747F64; Wed, 27 Dec 2023 20:41:45 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=rjwysocki.net Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.4.0) id de14cebbb85df213; Wed, 27 Dec 2023 21:41:43 +0100 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by cloudserver094114.home.pl (Postfix) with ESMTPSA id 23511668E17; Wed, 27 Dec 2023 21:41:43 +0100 (CET) From: "Rafael J. Wysocki" To: Greg KH , linux-pm@vger.kernel.org Cc: Youngmin Nam , rafael@kernel.org, linux-kernel@vger.kernel.org, d7271.choe@samsung.com, janghyuck.kim@samsung.com, hyesoo.yu@samsung.com, Alan Stern , Ulf Hansson Subject: [PATCH v1 2/3] async: Introduce async_schedule_dev_nocall() Date: Wed, 27 Dec 2023 21:38:23 +0100 Message-ID: <4874693.GXAFRqVoOG@kreacher> In-Reply-To: <6019796.lOV4Wx5bFT@kreacher> References: <5754861.DvuYhMxLoT@kreacher> <6019796.lOV4Wx5bFT@kreacher> Precedence: bulk X-Mailing-List: linux-kernel@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvkedrvddvledgudegudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopedutddprhgtphhtthhopehgrhgvghhkhheslhhinhhugihfohhunhgurghtihhonhdrohhrghdprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopeihohhunhhgmhhinhdrnhgrmhesshgrmhhsuhhnghdrtghomhdprhgtphhtthhopehrrghfrggvlheskhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepugejvdejuddrtghhohgvsehsrghmshhunhhgrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=10 Fuz1=10 Fuz2=10 Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki In preparation for subsequent changes, introduce a specialized variant of async_schedule_dev() that will not invoke the argument function synchronously when it cannot be scheduled for asynchronous execution. The new function, async_schedule_dev_nocall(), will be used for fixing possible deadlocks in the system-wide power management core code. Signed-off-by: Rafael J. Wysocki Reviewed-by: Stanislaw Gruszka for the = series. Tested-by: Youngmin Nam --- drivers/base/power/main.c | 12 ++++++++---- include/linux/async.h | 2 ++ kernel/async.c | 29 +++++++++++++++++++++++++++++ 3 files changed, 39 insertions(+), 4 deletions(-) Index: linux-pm/kernel/async.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/kernel/async.c +++ linux-pm/kernel/async.c @@ -244,6 +244,35 @@ async_cookie_t async_schedule_node(async EXPORT_SYMBOL_GPL(async_schedule_node); =20 /** + * async_schedule_dev_nocall - A simplified variant of async_schedule_dev() + * @func: function to execute asynchronously + * @dev: device argument to be passed to function + * + * @dev is used as both the argument for the function and to provide NUMA + * context for where to run the function. + * + * If the asynchronous execution of @func is scheduled successfully, return + * true. Otherwise, do nothing and return false, unlike async_schedule_dev= () + * that will run the function synchronously then. + */ +bool async_schedule_dev_nocall(async_func_t func, struct device *dev) +{ + struct async_entry *entry; + + entry =3D kzalloc(sizeof(struct async_entry), GFP_KERNEL); + + /* Give up if there is no memory or too much work. */ + if (!entry || atomic_read(&entry_count) > MAX_WORK) { + kfree(entry); + return false; + } + + __async_schedule_node_domain(func, dev, dev_to_node(dev), + &async_dfl_domain, entry); + return true; +} + +/** * async_synchronize_full - synchronize all asynchronous function calls * * This function waits until all asynchronous function calls have been don= e. Index: linux-pm/include/linux/async.h =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/include/linux/async.h +++ linux-pm/include/linux/async.h @@ -90,6 +90,8 @@ async_schedule_dev(async_func_t func, st return async_schedule_node(func, dev, dev_to_node(dev)); } =20 +bool async_schedule_dev_nocall(async_func_t func, struct device *dev); + /** * async_schedule_dev_domain - A device specific version of async_schedule= _domain * @func: function to execute asynchronously From nobody Sun Feb 8 02:53:40 2026 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 4A60647F4D; Wed, 27 Dec 2023 20:41:44 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=rjwysocki.net Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.4.0) id 5b718565e66a1574; Wed, 27 Dec 2023 21:41:42 +0100 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by cloudserver094114.home.pl (Postfix) with ESMTPSA id 5AEA0668E17; Wed, 27 Dec 2023 21:41:42 +0100 (CET) From: "Rafael J. Wysocki" To: Greg KH , linux-pm@vger.kernel.org Cc: Youngmin Nam , rafael@kernel.org, linux-kernel@vger.kernel.org, d7271.choe@samsung.com, janghyuck.kim@samsung.com, hyesoo.yu@samsung.com, Alan Stern , Ulf Hansson Subject: [PATCH v1 3/3] PM: sleep: Fix possible deadlocks in core system-wide PM code Date: Wed, 27 Dec 2023 21:41:06 +0100 Message-ID: <13435856.uLZWGnKmhe@kreacher> In-Reply-To: <6019796.lOV4Wx5bFT@kreacher> References: <5754861.DvuYhMxLoT@kreacher> <6019796.lOV4Wx5bFT@kreacher> Precedence: bulk X-Mailing-List: linux-kernel@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvkedrvddvledgudegudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpeefudduuedtuefgleffudeigeeitdeufeelvdejgefftdethffhhfethfeljefgteenucffohhmrghinhepkhgvrhhnvghlrdhorhhgnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepuddtpdhrtghpthhtohepghhrvghgkhhhsehlihhnuhigfhhouhhnuggrthhiohhnrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohephihouhhnghhmihhnrdhnrghmsehsrghmshhunhhgrdgtohhmpdhrtghpthhtoheprhgrfhgrvghlsehkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegujedvjedurdgthhhovgesshgrmhhsuhhnghdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=10 Fuz1=10 Fuz2=10 Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki It is reported that in low-memory situations the system-wide resume core code deadlocks, because async_schedule_dev() executes its argument function synchronously if it cannot allocate memory (an not only then) and that function attempts to acquire a mutex that is already held. Address this by changing the code in question to use async_schedule_dev_nocall() for scheduling the asynchronous execution of device suspend and resume functions and to directly run them synchronously if async_schedule_dev_nocall() returns false. Fixes: 09beebd8f93b ("PM: sleep: core: Switch back to async_schedule_dev()") Link: https://lore.kernel.org/linux-pm/ZYvjiqX6EsL15moe@perf/ Reported-by: Youngmin Nam Signed-off-by: Rafael J. Wysocki Tested-by: Youngmin Nam --- The commit pointed to by the Fixes: tag is the last one that modified the code in question, even though the bug had been there already before. Still, the fix will not apply to the code before that commit. --- drivers/base/power/main.c | 148 +++++++++++++++++++++--------------------= ----- 1 file changed, 68 insertions(+), 80 deletions(-) Index: linux-pm/drivers/base/power/main.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/base/power/main.c +++ linux-pm/drivers/base/power/main.c @@ -579,7 +579,7 @@ bool dev_pm_skip_resume(struct device *d } =20 /** - * device_resume_noirq - Execute a "noirq resume" callback for given devic= e. + * __device_resume_noirq - Execute a "noirq resume" callback for given dev= ice. * @dev: Device to handle. * @state: PM transition of the system being carried out. * @async: If true, the device is being resumed asynchronously. @@ -587,7 +587,7 @@ bool dev_pm_skip_resume(struct device *d * The driver of @dev will not receive interrupts while this function is b= eing * executed. */ -static int device_resume_noirq(struct device *dev, pm_message_t state, boo= l async) +static void __device_resume_noirq(struct device *dev, pm_message_t state, = bool async) { pm_callback_t callback =3D NULL; const char *info =3D NULL; @@ -655,7 +655,13 @@ Skip: Out: complete_all(&dev->power.completion); TRACE_RESUME(error); - return error; + + if (error) { + suspend_stats.failed_resume_noirq++; + dpm_save_failed_step(SUSPEND_RESUME_NOIRQ); + dpm_save_failed_dev(dev_name(dev)); + pm_dev_err(dev, state, async ? " async noirq" : " noirq", error); + } } =20 static bool is_async(struct device *dev) @@ -668,11 +674,15 @@ static bool dpm_async_fn(struct device * { reinit_completion(&dev->power.completion); =20 - if (is_async(dev)) { - get_device(dev); - async_schedule_dev(func, dev); + if (!is_async(dev)) + return false; + + get_device(dev); + + if (async_schedule_dev_nocall(func, dev)) return true; - } + + put_device(dev); =20 return false; } @@ -680,15 +690,19 @@ static bool dpm_async_fn(struct device * static void async_resume_noirq(void *data, async_cookie_t cookie) { struct device *dev =3D data; - int error; - - error =3D device_resume_noirq(dev, pm_transition, true); - if (error) - pm_dev_err(dev, pm_transition, " async", error); =20 + __device_resume_noirq(dev, pm_transition, true); put_device(dev); } =20 +static void device_resume_noirq(struct device *dev) +{ + if (dpm_async_fn(dev, async_resume_noirq)) + return; + + __device_resume_noirq(dev, pm_transition, false); +} + static void dpm_noirq_resume_devices(pm_message_t state) { struct device *dev; @@ -698,14 +712,6 @@ static void dpm_noirq_resume_devices(pm_ mutex_lock(&dpm_list_mtx); pm_transition =3D state; =20 - /* - * Advanced the async threads upfront, - * in case the starting of async threads is - * delayed by non-async resuming devices. - */ - list_for_each_entry(dev, &dpm_noirq_list, power.entry) - dpm_async_fn(dev, async_resume_noirq); - while (!list_empty(&dpm_noirq_list)) { dev =3D to_device(dpm_noirq_list.next); get_device(dev); @@ -713,17 +719,7 @@ static void dpm_noirq_resume_devices(pm_ =20 mutex_unlock(&dpm_list_mtx); =20 - if (!is_async(dev)) { - int error; - - error =3D device_resume_noirq(dev, state, false); - if (error) { - suspend_stats.failed_resume_noirq++; - dpm_save_failed_step(SUSPEND_RESUME_NOIRQ); - dpm_save_failed_dev(dev_name(dev)); - pm_dev_err(dev, state, " noirq", error); - } - } + device_resume_noirq(dev); =20 put_device(dev); =20 @@ -751,14 +747,14 @@ void dpm_resume_noirq(pm_message_t state } =20 /** - * device_resume_early - Execute an "early resume" callback for given devi= ce. + * __device_resume_early - Execute an "early resume" callback for given de= vice. * @dev: Device to handle. * @state: PM transition of the system being carried out. * @async: If true, the device is being resumed asynchronously. * * Runtime PM is disabled for @dev while this function is being executed. */ -static int device_resume_early(struct device *dev, pm_message_t state, boo= l async) +static void __device_resume_early(struct device *dev, pm_message_t state, = bool async) { pm_callback_t callback =3D NULL; const char *info =3D NULL; @@ -811,21 +807,31 @@ Out: =20 pm_runtime_enable(dev); complete_all(&dev->power.completion); - return error; + + if (error) { + suspend_stats.failed_resume_early++; + dpm_save_failed_step(SUSPEND_RESUME_EARLY); + dpm_save_failed_dev(dev_name(dev)); + pm_dev_err(dev, state, async ? " async early" : " early", error); + } } =20 static void async_resume_early(void *data, async_cookie_t cookie) { struct device *dev =3D data; - int error; - - error =3D device_resume_early(dev, pm_transition, true); - if (error) - pm_dev_err(dev, pm_transition, " async", error); =20 + __device_resume_early(dev, pm_transition, true); put_device(dev); } =20 +static void device_resume_early(struct device *dev) +{ + if (dpm_async_fn(dev, async_resume_early)) + return; + + __device_resume_early(dev, pm_transition, false); +} + /** * dpm_resume_early - Execute "early resume" callbacks for all devices. * @state: PM transition of the system being carried out. @@ -839,14 +845,6 @@ void dpm_resume_early(pm_message_t state mutex_lock(&dpm_list_mtx); pm_transition =3D state; =20 - /* - * Advanced the async threads upfront, - * in case the starting of async threads is - * delayed by non-async resuming devices. - */ - list_for_each_entry(dev, &dpm_late_early_list, power.entry) - dpm_async_fn(dev, async_resume_early); - while (!list_empty(&dpm_late_early_list)) { dev =3D to_device(dpm_late_early_list.next); get_device(dev); @@ -854,17 +852,7 @@ void dpm_resume_early(pm_message_t state =20 mutex_unlock(&dpm_list_mtx); =20 - if (!is_async(dev)) { - int error; - - error =3D device_resume_early(dev, state, false); - if (error) { - suspend_stats.failed_resume_early++; - dpm_save_failed_step(SUSPEND_RESUME_EARLY); - dpm_save_failed_dev(dev_name(dev)); - pm_dev_err(dev, state, " early", error); - } - } + device_resume_early(dev); =20 put_device(dev); =20 @@ -888,12 +876,12 @@ void dpm_resume_start(pm_message_t state EXPORT_SYMBOL_GPL(dpm_resume_start); =20 /** - * device_resume - Execute "resume" callbacks for given device. + * __device_resume - Execute "resume" callbacks for given device. * @dev: Device to handle. * @state: PM transition of the system being carried out. * @async: If true, the device is being resumed asynchronously. */ -static int device_resume(struct device *dev, pm_message_t state, bool asyn= c) +static void __device_resume(struct device *dev, pm_message_t state, bool a= sync) { pm_callback_t callback =3D NULL; const char *info =3D NULL; @@ -975,20 +963,30 @@ static int device_resume(struct device * =20 TRACE_RESUME(error); =20 - return error; + if (error) { + suspend_stats.failed_resume++; + dpm_save_failed_step(SUSPEND_RESUME); + dpm_save_failed_dev(dev_name(dev)); + pm_dev_err(dev, state, async ? " async" : "", error); + } } =20 static void async_resume(void *data, async_cookie_t cookie) { struct device *dev =3D data; - int error; =20 - error =3D device_resume(dev, pm_transition, true); - if (error) - pm_dev_err(dev, pm_transition, " async", error); + __device_resume(dev, pm_transition, true); put_device(dev); } =20 +static void device_resume(struct device *dev) +{ + if (dpm_async_fn(dev, async_resume)) + return; + + __device_resume(dev, pm_transition, false); +} + /** * dpm_resume - Execute "resume" callbacks for non-sysdev devices. * @state: PM transition of the system being carried out. @@ -1008,27 +1006,17 @@ void dpm_resume(pm_message_t state) pm_transition =3D state; async_error =3D 0; =20 - list_for_each_entry(dev, &dpm_suspended_list, power.entry) - dpm_async_fn(dev, async_resume); - while (!list_empty(&dpm_suspended_list)) { dev =3D to_device(dpm_suspended_list.next); + get_device(dev); - if (!is_async(dev)) { - int error; =20 - mutex_unlock(&dpm_list_mtx); + mutex_unlock(&dpm_list_mtx); =20 - error =3D device_resume(dev, state, false); - if (error) { - suspend_stats.failed_resume++; - dpm_save_failed_step(SUSPEND_RESUME); - dpm_save_failed_dev(dev_name(dev)); - pm_dev_err(dev, state, "", error); - } + device_resume(dev); + + mutex_lock(&dpm_list_mtx); =20 - mutex_lock(&dpm_list_mtx); - } if (!list_empty(&dev->power.entry)) list_move_tail(&dev->power.entry, &dpm_prepared_list);