From nobody Sat Feb 7 23:06:35 2026 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 02876C001DB for ; Thu, 3 Aug 2023 21:12:02 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231947AbjHCVMB (ORCPT ); Thu, 3 Aug 2023 17:12:01 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:36058 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229974AbjHCVL4 (ORCPT ); Thu, 3 Aug 2023 17:11:56 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id A2E4A30DD; Thu, 3 Aug 2023 14:11:51 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 0c0dc30f04e2f562; Thu, 3 Aug 2023 23:11:49 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 7115166241A; Thu, 3 Aug 2023 23:11:49 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM , Peter Zijlstra , Anna-Maria Behnsen Cc: LKML , Frederic Weisbecker , Kajetan Puchalski Subject: [RFT][PATCH v2 1/3] cpuidle: teo: Do not call tick_nohz_get_sleep_length() upfront Date: Thu, 03 Aug 2023 23:07:41 +0200 Message-ID: <4836344.GXAFRqVoOG@kreacher> In-Reply-To: <5712331.DvuYhMxLoT@kreacher> References: <5712331.DvuYhMxLoT@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkedvgdduheeiucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepiedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehpvghtvghriiesihhnfhhrrgguvggrugdrohhrghdprhgtphhtthhopegrnhhnrgdqmhgrrhhirgeslhhinhhuthhrohhnihigrdguvgdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehfrhgv uggvrhhitgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepkhgrjhgvthgrnhdrphhutghhrghlshhkihesrghrmhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki Because the cost of calling tick_nohz_get_sleep_length() may increase in the future, reorder the code in teo_select() so it first uses the statistics to pick up a candidate idle state and applies the utilization heuristic to it and only then calls tick_nohz_get_sleep_length() to obtain the sleep length value and refine the selection if necessary. This change by itself does not cause tick_nohz_get_sleep_length() to be called less often, but it prepares the code for subsequent changes that will do so. Signed-off-by: Rafael J. Wysocki Tested-by: Kajetan Puchalski --- v1 -> v2: * Fix up the "2 states and utilized CPU" special case handling, so it allows the tick to be stopped in all of the cases when the target residency of state 1 is above TICK_NSEC. * Fix up a stale comment. --- drivers/cpuidle/governors/teo.c | 105 ++++++++++++++++-------------------= ----- 1 file changed, 44 insertions(+), 61 deletions(-) Index: linux-pm/drivers/cpuidle/governors/teo.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/cpuidle/governors/teo.c +++ linux-pm/drivers/cpuidle/governors/teo.c @@ -306,15 +306,10 @@ static void teo_update(struct cpuidle_dr cpu_data->total +=3D PULSE; } =20 -static bool teo_time_ok(u64 interval_ns) +static bool teo_state_ok(int i, struct cpuidle_driver *drv) { - return !tick_nohz_tick_stopped() || interval_ns >=3D TICK_NSEC; -} - -static s64 teo_middle_of_bin(int idx, struct cpuidle_driver *drv) -{ - return (drv->states[idx].target_residency_ns + - drv->states[idx+1].target_residency_ns) / 2; + return !tick_nohz_tick_stopped() || + drv->states[i].target_residency_ns >=3D TICK_NSEC; } =20 /** @@ -354,6 +349,7 @@ static int teo_select(struct cpuidle_dri { struct teo_cpu *cpu_data =3D per_cpu_ptr(&teo_cpus, dev->cpu); s64 latency_req =3D cpuidle_governor_latency_req(dev->cpu); + ktime_t delta_tick =3D TICK_NSEC / 2; unsigned int idx_intercept_sum =3D 0; unsigned int intercept_sum =3D 0; unsigned int idx_recent_sum =3D 0; @@ -363,7 +359,6 @@ static int teo_select(struct cpuidle_dri int constraint_idx =3D 0; int idx0 =3D 0, idx =3D -1; bool alt_intercepts, alt_recent; - ktime_t delta_tick; bool cpu_utilized; s64 duration_ns; int i; @@ -374,9 +369,11 @@ static int teo_select(struct cpuidle_dri } =20 cpu_data->time_span_ns =3D local_clock(); - - duration_ns =3D tick_nohz_get_sleep_length(&delta_tick); - cpu_data->sleep_length_ns =3D duration_ns; + /* + * Set the expected sleep length to infinity in case of an early + * return. + */ + cpu_data->sleep_length_ns =3D KTIME_MAX; =20 /* Check if there is any choice in the first place. */ if (drv->state_count < 2) { @@ -384,11 +381,8 @@ static int teo_select(struct cpuidle_dri goto out_tick; } =20 - if (!dev->states_usage[0].disable) { + if (!dev->states_usage[0].disable) idx =3D 0; - if (drv->states[1].target_residency_ns > duration_ns) - goto out_tick; - } =20 cpu_utilized =3D teo_cpu_is_utilized(dev->cpu, cpu_data); /* @@ -397,8 +391,6 @@ static int teo_select(struct cpuidle_dri * the shallowest non-polling state and exit. */ if (drv->state_count < 3 && cpu_utilized) { - /* The CPU is utilized, so assume a short idle duration. */ - duration_ns =3D teo_middle_of_bin(0, drv); /* * If state 0 is enabled and it is not a polling one, select it * right away unless the scheduler tick has been stopped, in @@ -408,22 +400,17 @@ static int teo_select(struct cpuidle_dri * anyway. */ if ((!idx && !(drv->states[0].flags & CPUIDLE_FLAG_POLLING) && - teo_time_ok(duration_ns)) || dev->states_usage[1].disable) { + teo_state_ok(0, drv)) || dev->states_usage[1].disable) { idx =3D 0; goto out_tick; } /* Assume that state 1 is not a polling one and use it. */ idx =3D 1; + duration_ns =3D drv->states[1].target_residency_ns; goto end; } =20 - /* - * Find the deepest idle state whose target residency does not exceed - * the current sleep length and the deepest idle state not deeper than - * the former whose exit latency does not exceed the current latency - * constraint. Compute the sums of metrics for early wakeup pattern - * detection. - */ + /* Compute the sums of metrics for early wakeup pattern detection. */ for (i =3D 1; i < drv->state_count; i++) { struct teo_bin *prev_bin =3D &cpu_data->state_bins[i-1]; struct cpuidle_state *s =3D &drv->states[i]; @@ -439,19 +426,15 @@ static int teo_select(struct cpuidle_dri if (dev->states_usage[i].disable) continue; =20 - if (idx < 0) { - idx =3D i; /* first enabled state */ - idx0 =3D i; - } - - if (s->target_residency_ns > duration_ns) - break; + if (idx < 0) + idx0 =3D i; /* first enabled state */ =20 idx =3D i; =20 if (s->exit_latency_ns <=3D latency_req) constraint_idx =3D i; =20 + /* Save the sums for the current state. */ idx_intercept_sum =3D intercept_sum; idx_hit_sum =3D hit_sum; idx_recent_sum =3D recent_sum; @@ -465,7 +448,7 @@ static int teo_select(struct cpuidle_dri =20 if (idx =3D=3D idx0) { /* - * This is the first enabled idle state, so use it, but do not + * Only one idle state is enabled, so use it, but do not * allow the tick to be stopped it is shallow enough. */ duration_ns =3D drv->states[idx].target_residency_ns; @@ -479,13 +462,11 @@ static int teo_select(struct cpuidle_dri * all of the deeper states, or the sum of the numbers of recent * intercepts over all of the states shallower than the candidate one * is greater than a half of the number of recent events taken into - * account, the CPU is likely to wake up early, so find an alternative - * idle state to select. + * account, a shallower idle state is likely to be a better choice. */ alt_intercepts =3D 2 * idx_intercept_sum > cpu_data->total - idx_hit_sum; alt_recent =3D idx_recent_sum > NR_RECENT / 2; if (alt_recent || alt_intercepts) { - s64 first_suitable_span_ns =3D duration_ns; int first_suitable_idx =3D idx; =20 /* @@ -494,44 +475,39 @@ static int teo_select(struct cpuidle_dri * cases (both with respect to intercepts overall and with * respect to the recent intercepts only) in the past. * - * Take the possible latency constraint and duration limitation - * present if the tick has been stopped already into account. + * Take the possible duration limitation present if the tick + * has been stopped already into account. */ intercept_sum =3D 0; recent_sum =3D 0; =20 for (i =3D idx - 1; i >=3D 0; i--) { struct teo_bin *bin =3D &cpu_data->state_bins[i]; - s64 span_ns; =20 intercept_sum +=3D bin->intercepts; recent_sum +=3D bin->recent; =20 - span_ns =3D teo_middle_of_bin(i, drv); - if ((!alt_recent || 2 * recent_sum > idx_recent_sum) && (!alt_intercepts || 2 * intercept_sum > idx_intercept_sum)) { - if (teo_time_ok(span_ns) && - !dev->states_usage[i].disable) { + /* + * Use the current state unless it is too + * shallow or disabled, in which case take the + * first enabled state that is deep enough. + */ + if (teo_state_ok(i, drv) && + !dev->states_usage[i].disable) idx =3D i; - duration_ns =3D span_ns; - } else { - /* - * The current state is too shallow or - * disabled, so take the first enabled - * deeper state with suitable time span. - */ + else idx =3D first_suitable_idx; - duration_ns =3D first_suitable_span_ns; - } + break; } =20 if (dev->states_usage[i].disable) continue; =20 - if (!teo_time_ok(span_ns)) { + if (!teo_state_ok(i, drv)) { /* * The current state is too shallow, but if an * alternative candidate state has been found, @@ -543,7 +519,6 @@ static int teo_select(struct cpuidle_dri break; } =20 - first_suitable_span_ns =3D span_ns; first_suitable_idx =3D i; } } @@ -562,14 +537,22 @@ static int teo_select(struct cpuidle_dri * not sufficiently large. */ if (cpu_utilized) { - s64 span_ns; + i =3D teo_find_shallower_state(drv, dev, idx, KTIME_MAX, true); + if (teo_state_ok(i, drv)) + idx =3D i; + } =20 - i =3D teo_find_shallower_state(drv, dev, idx, duration_ns, true); - span_ns =3D teo_middle_of_bin(i, drv); - if (teo_time_ok(span_ns)) { + duration_ns =3D tick_nohz_get_sleep_length(&delta_tick); + cpu_data->sleep_length_ns =3D duration_ns; + + /* + * If the closest expected timer is before the terget residency of the + * candidate state, a shallower one needs to be found. + */ + if (drv->states[idx].target_residency_ns > duration_ns) { + i =3D teo_find_shallower_state(drv, dev, idx, duration_ns, false); + if (teo_state_ok(i, drv)) idx =3D i; - duration_ns =3D span_ns; - } } =20 end: From nobody Sat Feb 7 23:06:35 2026 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id A8850C04A6A for ; Thu, 3 Aug 2023 21:12:00 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231449AbjHCVL7 (ORCPT ); Thu, 3 Aug 2023 17:11:59 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:36056 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229904AbjHCVL4 (ORCPT ); Thu, 3 Aug 2023 17:11:56 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id D0A6E30DB; Thu, 3 Aug 2023 14:11:50 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id d1add525cb99f3b2; Thu, 3 Aug 2023 23:11:49 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id B77C666241A; Thu, 3 Aug 2023 23:11:48 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM , Peter Zijlstra , Anna-Maria Behnsen Cc: LKML , Frederic Weisbecker , Kajetan Puchalski Subject: [RFT][PATCH v2 2/3] cpuidle: teo: Skip tick_nohz_get_sleep_length() call in some cases Date: Thu, 03 Aug 2023 23:09:18 +0200 Message-ID: <2167194.irdbgypaU6@kreacher> In-Reply-To: <5712331.DvuYhMxLoT@kreacher> References: <5712331.DvuYhMxLoT@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkedvgdduheehucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepiedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehpvghtvghriiesihhnfhhrrgguvggrugdrohhrghdprhgtphhtthhopegrnhhnrgdqmhgrrhhirgeslhhinhhuthhrohhnihigrdguvgdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehfrhgv uggvrhhitgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepkhgrjhgvthgrnhdrphhutghhrghlshhkihesrghrmhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki Make teo_select() avoid calling tick_nohz_get_sleep_length() if the candidate idle state to return is state 0 or if state 0 is a polling one and the target residency of the current candidate one is below a certain threshold, in which cases it may be assumed that the CPU will be woken up immediately by a non-timer wakeup source and the timers are not likely to matter. Signed-off-by: Rafael J. Wysocki Tested-by: Kajetan Puchalski --- v1 -> v2: No changes --- drivers/cpuidle/governors/teo.c | 22 ++++++++++++++++++++++ 1 file changed, 22 insertions(+) Index: linux-pm/drivers/cpuidle/governors/teo.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/cpuidle/governors/teo.c +++ linux-pm/drivers/cpuidle/governors/teo.c @@ -166,6 +166,12 @@ */ #define NR_RECENT 9 =20 +/* + * Idle state target residency threshold used for deciding whether or not = to + * check the time till the closest expected timer event. + */ +#define RESIDENCY_THRESHOLD_NS (15 * NSEC_PER_USEC) + /** * struct teo_bin - Metrics used by the TEO cpuidle governor. * @intercepts: The "intercepts" metric. @@ -542,6 +548,22 @@ static int teo_select(struct cpuidle_dri idx =3D i; } =20 + /* + * Skip the timers check if state 0 is the current candidate one, + * because an immediate non-timer wakeup is expected in that case. + */ + if (!idx) + goto out_tick; + + /* + * If state 0 is a polling one, check if the target residency of + * the current candidate state is low enough and skip the timers + * check in that case too. + */ + if ((drv->states[0].flags & CPUIDLE_FLAG_POLLING) && + drv->states[idx].target_residency_ns < RESIDENCY_THRESHOLD_NS) + goto out_tick; + duration_ns =3D tick_nohz_get_sleep_length(&delta_tick); cpu_data->sleep_length_ns =3D duration_ns; From nobody Sat Feb 7 23:06:35 2026 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 5E4F4C001DB for ; Thu, 3 Aug 2023 21:12:09 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S232571AbjHCVMH (ORCPT ); Thu, 3 Aug 2023 17:12:07 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:36054 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230233AbjHCVL4 (ORCPT ); Thu, 3 Aug 2023 17:11:56 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id D01702D42; Thu, 3 Aug 2023 14:11:50 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 944377c858fec3cf; Thu, 3 Aug 2023 23:11:48 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 01AB766241A; Thu, 3 Aug 2023 23:11:47 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM , Peter Zijlstra , Anna-Maria Behnsen Cc: LKML , Frederic Weisbecker , Kajetan Puchalski Subject: [RFT][PATCH v2 3/3] cpuidle: teo: Gather statistics regarding whether or not to stop the tick Date: Thu, 03 Aug 2023 23:11:40 +0200 Message-ID: <3258054.aeNJFYEL58@kreacher> In-Reply-To: <5712331.DvuYhMxLoT@kreacher> References: <5712331.DvuYhMxLoT@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkedvgdduheeiucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepiedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehpvghtvghriiesihhnfhhrrgguvggrugdrohhrghdprhgtphhtthhopegrnhhnrgdqmhgrrhhirgeslhhinhhuthhrohhnihigrdguvgdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehfrhgv uggvrhhitgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepkhgrjhgvthgrnhdrphhutghhrghlshhkihesrghrmhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki Currently, if the target residency of the deepest idle state is less than the tick period length, which is quite likely for HZ=3D100, and the deepest idle state is about to be selected by the TEO idle governor, the decision on whether or not to stop the scheduler tick is based entirely on the time till the closest timer. This is often insufficient, because timers may not be in heavy use and there may be a plenty of other CPU wakeup events between the deepest idle state's target residency and the closest tick. Allow the governor to count those events by making the deepest idle state's bin effectively end at TICK_NSEC and introducing an additional "bin" for collecting "hit" events (ie. the ones in which the measured idle duration falls into the same bin as the time till the closest timer) with idle duration values past TICK_NSEC. This way the "intercepts" metric for the deepest idle state's bin becomes nonzero in general, and so it can influence the decision on whether or not to stop the tick possibly increasing the governor's accuracy in that respect. Signed-off-by: Rafael J. Wysocki Tested-by: Kajetan Puchalski --- drivers/cpuidle/governors/teo.c | 41 +++++++++++++++++++++++++++++++++++= ++++- 1 file changed, 40 insertions(+), 1 deletion(-) Index: linux-pm/drivers/cpuidle/governors/teo.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/cpuidle/governors/teo.c +++ linux-pm/drivers/cpuidle/governors/teo.c @@ -192,6 +192,7 @@ struct teo_bin { * @total: Grand total of the "intercepts" and "hits" metrics for all bins. * @next_recent_idx: Index of the next @recent_idx entry to update. * @recent_idx: Indices of bins corresponding to recent "intercepts". + * @tick_hits: Number of "hits" after TICK_NSEC. * @util_threshold: Threshold above which the CPU is considered utilized */ struct teo_cpu { @@ -201,6 +202,7 @@ struct teo_cpu { unsigned int total; int next_recent_idx; int recent_idx[NR_RECENT]; + unsigned int tick_hits; unsigned long util_threshold; }; =20 @@ -232,6 +234,7 @@ static void teo_update(struct cpuidle_dr { struct teo_cpu *cpu_data =3D per_cpu_ptr(&teo_cpus, dev->cpu); int i, idx_timer =3D 0, idx_duration =3D 0; + s64 target_residency_ns; u64 measured_ns; =20 if (cpu_data->time_span_ns >=3D cpu_data->sleep_length_ns) { @@ -272,7 +275,6 @@ static void teo_update(struct cpuidle_dr * fall into. */ for (i =3D 0; i < drv->state_count; i++) { - s64 target_residency_ns =3D drv->states[i].target_residency_ns; struct teo_bin *bin =3D &cpu_data->state_bins[i]; =20 bin->hits -=3D bin->hits >> DECAY_SHIFT; @@ -280,6 +282,8 @@ static void teo_update(struct cpuidle_dr =20 cpu_data->total +=3D bin->hits + bin->intercepts; =20 + target_residency_ns =3D drv->states[i].target_residency_ns; + if (target_residency_ns <=3D cpu_data->sleep_length_ns) { idx_timer =3D i; if (target_residency_ns <=3D measured_ns) @@ -295,6 +299,26 @@ static void teo_update(struct cpuidle_dr cpu_data->state_bins[cpu_data->recent_idx[i]].recent--; =20 /* + * If the deepest state's target residency is below the tick length, + * make a record of it to help teo_select() decide whether or not + * to stop the tick. This effectively adds an extra hits-only bin + * beyond the last state-related one. + */ + if (target_residency_ns < TICK_NSEC) { + cpu_data->tick_hits -=3D cpu_data->tick_hits >> DECAY_SHIFT; + + cpu_data->total +=3D cpu_data->tick_hits; + + if (TICK_NSEC <=3D cpu_data->sleep_length_ns) { + idx_timer =3D drv->state_count; + if (TICK_NSEC <=3D measured_ns) { + cpu_data->tick_hits +=3D PULSE; + goto end; + } + } + } + + /* * If the measured idle duration falls into the same bin as the sleep * length, this is a "hit", so update the "hits" metric for that bin. * Otherwise, update the "intercepts" metric for the bin fallen into by @@ -309,6 +333,7 @@ static void teo_update(struct cpuidle_dr cpu_data->recent_idx[i] =3D idx_duration; } =20 +end: cpu_data->total +=3D PULSE; } =20 @@ -356,6 +381,7 @@ static int teo_select(struct cpuidle_dri struct teo_cpu *cpu_data =3D per_cpu_ptr(&teo_cpus, dev->cpu); s64 latency_req =3D cpuidle_governor_latency_req(dev->cpu); ktime_t delta_tick =3D TICK_NSEC / 2; + unsigned int tick_intercept_sum =3D 0; unsigned int idx_intercept_sum =3D 0; unsigned int intercept_sum =3D 0; unsigned int idx_recent_sum =3D 0; @@ -429,6 +455,8 @@ static int teo_select(struct cpuidle_dri hit_sum +=3D prev_bin->hits; recent_sum +=3D prev_bin->recent; =20 + tick_intercept_sum =3D intercept_sum; + if (dev->states_usage[i].disable) continue; =20 @@ -461,6 +489,8 @@ static int teo_select(struct cpuidle_dri goto end; } =20 + tick_intercept_sum +=3D cpu_data->state_bins[drv->state_count-1].intercep= ts; + /* * If the sum of the intercepts metric for all of the idle states * shallower than the current candidate one (idx) is greater than the @@ -577,6 +607,15 @@ static int teo_select(struct cpuidle_dri idx =3D i; } =20 + /* + * If the selected state's target residency is below the tick length + * and intercepts occurring before the tick length are the majority of + * total wakeup events, do not stop the tick. + */ + if (drv->states[idx].target_residency_ns < TICK_NSEC && + tick_intercept_sum > cpu_data->total / 2 + cpu_data->total / 8) + duration_ns =3D TICK_NSEC / 2; + end: /* * Allow the tick to be stopped unless the selected state is a polling