From nobody Sun Feb 8 05:29:19 2026 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 4DE37C001E0 for ; Mon, 31 Jul 2023 19:05:07 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231237AbjGaTFF (ORCPT ); Mon, 31 Jul 2023 15:05:05 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:42706 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230381AbjGaTE5 (ORCPT ); Mon, 31 Jul 2023 15:04:57 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 986261710; Mon, 31 Jul 2023 12:04:55 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id d3f93b39a0953369; Mon, 31 Jul 2023 21:04:54 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id AAF8A6620E2; Mon, 31 Jul 2023 21:04:53 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Peter Zijlstra , Anna-Maria Behnsen , Frederic Weisbecker , Kajetan Puchalski Subject: [PATCH v3 1/3] cpuidle: teo: Update idle duration estimate when choosing shallower state Date: Mon, 31 Jul 2023 20:56:35 +0200 Message-ID: <13332551.uLZWGnKmhe@kreacher> In-Reply-To: <4515817.LvFx2qVVIh@kreacher> References: <4515817.LvFx2qVVIh@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrjeeggddutdekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepfeduudeutdeugfelffduieegiedtueefledvjeegffdttefhhffhtefhleejgfetnecuffhomhgrihhnpehkvghrnhgvlhdrohhrghenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepphgvthgvrhiisehinhhfrhgruggvrggurdhorhhgpdhrtghpthhtoheprghnnhgrqdhmrghrihgrsehlihhnuhht rhhonhhigidruggvpdhrtghpthhtohepfhhrvgguvghrihgtsehkvghrnhgvlhdrohhrghdprhgtphhtthhopehkrghjvghtrghnrdhpuhgthhgrlhhskhhisegrrhhmrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki The TEO governor takes CPU utilization into account by refining idle state selection when the utilization is above a certain threshold. This is done = by choosing an idle state shallower than the previously selected one. However, when doing this, the idle duration estimate needs to be adjusted so as to prevent the scheduler tick from being stopped when the candidate idle state is shallow, which may lead to excessive energy usage if the CPU is not woken up quickly enough going forward. Moreover, if the scheduler tick has been stopped already and the new idle duration estimate is too small, the replacement candidate state cannot be used. Modify the relevant code to take the above observations into account. Fixes: 9ce0f7c4bc64 ("cpuidle: teo: Introduce util-awareness") Link: https://lore.kernel.org/linux-pm/CAJZ5v0jJxHj65r2HXBTd3wfbZtsg=3D_Stz= wO1kA5STDnaPe_dWA@mail.gmail.com Signed-off-by: Rafael J. Wysocki --- v2 -> v3: * Make the handling of the "2 idle state and utilized CPU" case more straightforward. v1 -> v2: * Rework the code handling the special case when the CPU is utilized and there are only 2 idle states (drop the loop, avoid using state 0 when the tick has been stopped already and it is too shallow, check if state 1 is not disabled when about to use it, set low idle duration estimate). * Changelog edits. --- drivers/cpuidle/governors/teo.c | 40 ++++++++++++++++++++++++++++++-----= ----- 1 file changed, 30 insertions(+), 10 deletions(-) Index: linux-pm/drivers/cpuidle/governors/teo.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/cpuidle/governors/teo.c +++ linux-pm/drivers/cpuidle/governors/teo.c @@ -397,13 +397,23 @@ static int teo_select(struct cpuidle_dri * the shallowest non-polling state and exit. */ if (drv->state_count < 3 && cpu_data->utilized) { - for (i =3D 0; i < drv->state_count; ++i) { - if (!dev->states_usage[i].disable && - !(drv->states[i].flags & CPUIDLE_FLAG_POLLING)) { - idx =3D i; - goto end; - } - } + /* The CPU is utilized, so assume a short idle duration. */ + duration_ns =3D teo_middle_of_bin(0, drv); + /* + * If state 0 is enabled and it is not a polling one, select it + * right away unless the scheduler tick has been stopped, in + * which case care needs to be taken to leave the CPU in a deep + * enough state in case it is not woken up any time soon after + * all. If state 1 is disabled, though, state 0 must be used + * anyway. + */ + if ((!idx && !(drv->states[0].flags & CPUIDLE_FLAG_POLLING) && + teo_time_ok(duration_ns)) || dev->states_usage[1].disable) + idx =3D 0; + else /* Assume that state 1 is not a polling one and use it. */ + idx =3D 1; + + goto end; } =20 /* @@ -539,10 +549,20 @@ static int teo_select(struct cpuidle_dri =20 /* * If the CPU is being utilized over the threshold, choose a shallower - * non-polling state to improve latency + * non-polling state to improve latency, unless the scheduler tick has + * been stopped already and the shallower state's target residency is + * not sufficiently large. */ - if (cpu_data->utilized) - idx =3D teo_find_shallower_state(drv, dev, idx, duration_ns, true); + if (cpu_data->utilized) { + s64 span_ns; + + i =3D teo_find_shallower_state(drv, dev, idx, duration_ns, true); + span_ns =3D teo_middle_of_bin(i, drv); + if (teo_time_ok(span_ns)) { + idx =3D i; + duration_ns =3D span_ns; + } + } =20 end: /* From nobody Sun Feb 8 05:29:19 2026 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 25167C001E0 for ; Mon, 31 Jul 2023 19:05:04 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231231AbjGaTFC (ORCPT ); Mon, 31 Jul 2023 15:05:02 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:42698 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229798AbjGaTE4 (ORCPT ); Mon, 31 Jul 2023 15:04:56 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 4F7A01707; Mon, 31 Jul 2023 12:04:55 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id e66c7d44df33c50a; Mon, 31 Jul 2023 21:04:53 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id EAC776620E2; Mon, 31 Jul 2023 21:04:52 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Peter Zijlstra , Anna-Maria Behnsen , Frederic Weisbecker , Kajetan Puchalski Subject: [PATCH v3 2/3] cpuidle: teo: Avoid stopping the tick unnecessarily when bailing out Date: Mon, 31 Jul 2023 21:03:09 +0200 Message-ID: <10328871.nUPlyArG6x@kreacher> In-Reply-To: <4515817.LvFx2qVVIh@kreacher> References: <4515817.LvFx2qVVIh@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrjeeggddutdekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepfeduudeutdeugfelffduieegiedtueefledvjeegffdttefhhffhtefhleejgfetnecuffhomhgrihhnpehkvghrnhgvlhdrohhrghenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepphgvthgvrhiisehinhhfrhgruggvrggurdhorhhgpdhrtghpthhtoheprghnnhgrqdhmrghrihgrsehlihhnuhht rhhonhhigidruggvpdhrtghpthhtohepfhhrvgguvghrihgtsehkvghrnhgvlhdrohhrghdprhgtphhtthhopehkrghjvghtrghnrdhpuhgthhgrlhhskhhisegrrhhmrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki When teo_select() is going to return early in some special cases, make it avoid stopping the tick if the idle state to be returned is shallow. In particular, never stop the tick if state 0 is to be returned. Link: https://lore.kernel.org/linux-pm/CAJZ5v0jJxHj65r2HXBTd3wfbZtsg=3D_Stz= wO1kA5STDnaPe_dWA@mail.gmail.com Signed-off-by: Rafael J. Wysocki --- v2 -> v3: * Cover all of the special cases when 0 is returned and never stop the t= ick in those cases. * Do not bail out when constraint_idx becomes the candidate state (it sh= ould be subject to the usual checks below, because it isn't really special). * Be more careful about stopping the tick when the first enabled idle st= ate is used. v1 -> v2: New patch --- drivers/cpuidle/governors/teo.c | 56 +++++++++++++++++++++++------------= ----- 1 file changed, 33 insertions(+), 23 deletions(-) Index: linux-pm/drivers/cpuidle/governors/teo.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/cpuidle/governors/teo.c +++ linux-pm/drivers/cpuidle/governors/teo.c @@ -382,12 +382,13 @@ static int teo_select(struct cpuidle_dri /* Check if there is any choice in the first place. */ if (drv->state_count < 2) { idx =3D 0; - goto end; + goto out_tick; } + if (!dev->states_usage[0].disable) { idx =3D 0; if (drv->states[1].target_residency_ns > duration_ns) - goto end; + goto out_tick; } =20 cpu_data->utilized =3D teo_cpu_is_utilized(dev->cpu, cpu_data); @@ -408,11 +409,12 @@ static int teo_select(struct cpuidle_dri * anyway. */ if ((!idx && !(drv->states[0].flags & CPUIDLE_FLAG_POLLING) && - teo_time_ok(duration_ns)) || dev->states_usage[1].disable) + teo_time_ok(duration_ns)) || dev->states_usage[1].disable) { idx =3D 0; - else /* Assume that state 1 is not a polling one and use it. */ - idx =3D 1; - + goto out_tick; + } + /* Assume that state 1 is not a polling one and use it. */ + idx =3D 1; goto end; } =20 @@ -459,8 +461,15 @@ static int teo_select(struct cpuidle_dri /* Avoid unnecessary overhead. */ if (idx < 0) { idx =3D 0; /* No states enabled, must use 0. */ - goto end; - } else if (idx =3D=3D idx0) { + goto out_tick; + } + + if (idx =3D=3D idx0) { + /* + * This is the first enabled idle state, so use it, but do not + * allow the tick to be stopped it is shallow enough. + */ + duration_ns =3D drv->states[idx].target_residency_ns; goto end; } =20 @@ -566,24 +575,25 @@ static int teo_select(struct cpuidle_dri =20 end: /* - * Don't stop the tick if the selected state is a polling one or if the - * expected idle duration is shorter than the tick period length. + * Allow the tick to be stopped unless the selected state is a polling + * one or the expected idle duration is shorter than the tick period + * length. */ - if (((drv->states[idx].flags & CPUIDLE_FLAG_POLLING) || - duration_ns < TICK_NSEC) && !tick_nohz_tick_stopped()) { - *stop_tick =3D false; + if ((!(drv->states[idx].flags & CPUIDLE_FLAG_POLLING) && + duration_ns >=3D TICK_NSEC) || tick_nohz_tick_stopped()) + return idx; =20 - /* - * The tick is not going to be stopped, so if the target - * residency of the state to be returned is not within the time - * till the closest timer including the tick, try to correct - * that. - */ - if (idx > idx0 && - drv->states[idx].target_residency_ns > delta_tick) - idx =3D teo_find_shallower_state(drv, dev, idx, delta_tick, false); - } + /* + * The tick is not going to be stopped, so if the target residency of + * the state to be returned is not within the time till the closest + * timer including the tick, try to correct that. + */ + if (idx > idx0 && + drv->states[idx].target_residency_ns > delta_tick) + idx =3D teo_find_shallower_state(drv, dev, idx, delta_tick, false); =20 +out_tick: + *stop_tick =3D false; return idx; } From nobody Sun Feb 8 05:29:19 2026 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 6C34EC41513 for ; Mon, 31 Jul 2023 19:05:00 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231166AbjGaTE6 (ORCPT ); Mon, 31 Jul 2023 15:04:58 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:42700 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229618AbjGaTE4 (ORCPT ); Mon, 31 Jul 2023 15:04:56 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 4F882170A; Mon, 31 Jul 2023 12:04:55 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 32ce0183077fd9b9; Mon, 31 Jul 2023 21:04:52 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 314E16620E2; Mon, 31 Jul 2023 21:04:52 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Peter Zijlstra , Anna-Maria Behnsen , Frederic Weisbecker , Kajetan Puchalski Subject: [PATCH v3 3/3] cpuidle: teo: Drop utilized from struct teo_cpu Date: Mon, 31 Jul 2023 21:04:41 +0200 Message-ID: <1953519.PYKUYFuaPT@kreacher> In-Reply-To: <4515817.LvFx2qVVIh@kreacher> References: <4515817.LvFx2qVVIh@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrjeeggddutdelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepiedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehpvghtvghriiesihhnfhhrrgguvggrugdrohhrghdprhgtphhtthhopegrnhhnrgdqmhgrrhhirgeslhhinhhuthhrohhnihigrdguvgdprhgtphhtthhopehfrhgv uggvrhhitgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepkhgrjhgvthgrnhdrphhutghhrghlshhkihesrghrmhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki Because the utilized field in struct teo_cpu is only used locally in teo_select(), replace it with a local variable in that function. No intentional functional impact. Signed-off-by: Rafael J. Wysocki --- v2 -> v3: No changes v1 -> v2: New patch --- drivers/cpuidle/governors/teo.c | 9 ++++----- 1 file changed, 4 insertions(+), 5 deletions(-) Index: linux-pm/drivers/cpuidle/governors/teo.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/cpuidle/governors/teo.c +++ linux-pm/drivers/cpuidle/governors/teo.c @@ -187,7 +187,6 @@ struct teo_bin { * @next_recent_idx: Index of the next @recent_idx entry to update. * @recent_idx: Indices of bins corresponding to recent "intercepts". * @util_threshold: Threshold above which the CPU is considered utilized - * @utilized: Whether the last sleep on the CPU happened while utilized */ struct teo_cpu { s64 time_span_ns; @@ -197,7 +196,6 @@ struct teo_cpu { int next_recent_idx; int recent_idx[NR_RECENT]; unsigned long util_threshold; - bool utilized; }; =20 static DEFINE_PER_CPU(struct teo_cpu, teo_cpus); @@ -366,6 +364,7 @@ static int teo_select(struct cpuidle_dri int idx0 =3D 0, idx =3D -1; bool alt_intercepts, alt_recent; ktime_t delta_tick; + bool cpu_utilized; s64 duration_ns; int i; =20 @@ -391,13 +390,13 @@ static int teo_select(struct cpuidle_dri goto out_tick; } =20 - cpu_data->utilized =3D teo_cpu_is_utilized(dev->cpu, cpu_data); + cpu_utilized =3D teo_cpu_is_utilized(dev->cpu, cpu_data); /* * If the CPU is being utilized over the threshold and there are only 2 * states to choose from, the metrics need not be considered, so choose * the shallowest non-polling state and exit. */ - if (drv->state_count < 3 && cpu_data->utilized) { + if (drv->state_count < 3 && cpu_utilized) { /* The CPU is utilized, so assume a short idle duration. */ duration_ns =3D teo_middle_of_bin(0, drv); /* @@ -562,7 +561,7 @@ static int teo_select(struct cpuidle_dri * been stopped already and the shallower state's target residency is * not sufficiently large. */ - if (cpu_data->utilized) { + if (cpu_utilized) { s64 span_ns; =20 i =3D teo_find_shallower_state(drv, dev, idx, duration_ns, true);