From nobody Wed Dec 17 09:18:36 2025 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 5AED6EE49AC for ; Tue, 22 Aug 2023 11:49:12 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S235379AbjHVLtM (ORCPT ); Tue, 22 Aug 2023 07:49:12 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:50954 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S233339AbjHVLtL (ORCPT ); Tue, 22 Aug 2023 07:49:11 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id DE468E7B; Tue, 22 Aug 2023 04:48:49 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 09be78d781e11d50; Tue, 22 Aug 2023 13:40:06 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 06EF4662D25; Tue, 22 Aug 2023 13:40:06 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM , Linux ACPI Cc: LKML , Daniel Lezcano , Zhang Rui , Srinivas Pandruvada , Amit Kucheria , linux-omap@vger.kernel.org Subject: [PATCH v1] thermal: core: Rework .get_trend() thermal zone callback Date: Tue, 22 Aug 2023 13:40:06 +0200 Message-ID: <4511659.LvFx2qVVIh@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedruddvuddggedvucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepffffffekgfehheffleetieevfeefvefhleetjedvvdeijeejledvieehueevueffnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepkedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthht oheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=8 Fuz1=8 Fuz2=8 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki Passing a struct thermal_trip pointer instead of a trip index to the .get_trend() thermal zone callback allows one of its 2 implementations, the thermal_get_trend() function in the ACPI thermal driver, to be simplified quite a bit, and the other implementation of it in the ti-soc-thermal driver does not even use the relevant callback argument. For this reason, change the .get_trend() thermal zone callback definition and adjust the related code accordingly. Signed-off-by: Rafael J. Wysocki --- This is based on the thermal branch in linux-pm.git (which is also included in the linux-next branch of that tree). --- drivers/acpi/thermal.c | 41 +++++++++-------= ----- drivers/thermal/thermal_core.h | 2 - drivers/thermal/thermal_helpers.c | 3 + drivers/thermal/ti-soc-thermal/ti-thermal-common.c | 3 + include/linux/thermal.h | 30 +++++++-------- 5 files changed, 38 insertions(+), 41 deletions(-) Index: linux-pm/include/linux/thermal.h =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/include/linux/thermal.h +++ linux-pm/include/linux/thermal.h @@ -53,6 +53,20 @@ enum thermal_notify_event { THERMAL_EVENT_KEEP_ALIVE, /* Request for user space handler to respond */ }; =20 +/** + * struct thermal_trip - representation of a point in temperature domain + * @temperature: temperature value in miliCelsius + * @hysteresis: relative hysteresis in miliCelsius + * @type: trip point type + * @priv: pointer to driver data associated with this trip + */ +struct thermal_trip { + int temperature; + int hysteresis; + enum thermal_trip_type type; + void *priv; +}; + struct thermal_zone_device_ops { int (*bind) (struct thermal_zone_device *, struct thermal_cooling_device *); @@ -70,26 +84,12 @@ struct thermal_zone_device_ops { int (*set_trip_hyst) (struct thermal_zone_device *, int, int); int (*get_crit_temp) (struct thermal_zone_device *, int *); int (*set_emul_temp) (struct thermal_zone_device *, int); - int (*get_trend) (struct thermal_zone_device *, int, + int (*get_trend) (struct thermal_zone_device *, struct thermal_trip *, enum thermal_trend *); void (*hot)(struct thermal_zone_device *); void (*critical)(struct thermal_zone_device *); }; =20 -/** - * struct thermal_trip - representation of a point in temperature domain - * @temperature: temperature value in miliCelsius - * @hysteresis: relative hysteresis in miliCelsius - * @type: trip point type - * @priv: pointer to driver data associated with this trip - */ -struct thermal_trip { - int temperature; - int hysteresis; - enum thermal_trip_type type; - void *priv; -}; - struct thermal_cooling_device_ops { int (*get_max_state) (struct thermal_cooling_device *, unsigned long *); int (*get_cur_state) (struct thermal_cooling_device *, unsigned long *); Index: linux-pm/drivers/acpi/thermal.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -492,26 +492,22 @@ static int thermal_get_temp(struct therm } =20 static int thermal_get_trend(struct thermal_zone_device *thermal, - int trip_index, enum thermal_trend *trend) + struct thermal_trip *trip, + enum thermal_trend *trend) { struct acpi_thermal *tz =3D thermal_zone_device_priv(thermal); struct acpi_thermal_trip *acpi_trip; - int t, i; + int t; =20 - if (!tz || trip_index < 0) + if (!tz || !trip) return -EINVAL; =20 - if (tz->trips.critical.valid) - trip_index--; - - if (tz->trips.hot.valid) - trip_index--; - - if (trip_index < 0) + acpi_trip =3D trip->priv; + if (!acpi_trip || !acpi_trip->valid) return -EINVAL; =20 - acpi_trip =3D &tz->trips.passive.trip; - if (acpi_trip->valid && !trip_index--) { + switch (trip->type) { + case THERMAL_TRIP_PASSIVE: t =3D tz->trips.passive.tc1 * (tz->temperature - tz->last_temperature) + tz->trips.passive.tc2 * (tz->temperature - @@ -524,19 +520,18 @@ static int thermal_get_trend(struct ther *trend =3D THERMAL_TREND_STABLE; =20 return 0; - } - - t =3D acpi_thermal_temp(tz, tz->temperature); =20 - for (i =3D 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { - acpi_trip =3D &tz->trips.active[i].trip; - if (acpi_trip->valid && !trip_index--) { - if (t > acpi_thermal_temp(tz, acpi_trip->temperature)) { - *trend =3D THERMAL_TREND_RAISING; - return 0; - } + case THERMAL_TRIP_ACTIVE: + t =3D acpi_thermal_temp(tz, tz->temperature); + if (t <=3D trip->temperature) break; - } + + *trend =3D THERMAL_TREND_RAISING; + + return 0; + + default: + break; } =20 return -EINVAL; Index: linux-pm/drivers/thermal/thermal_core.h =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/thermal/thermal_core.h +++ linux-pm/drivers/thermal/thermal_core.h @@ -70,7 +70,7 @@ static inline bool cdev_is_power_actor(s void thermal_cdev_update(struct thermal_cooling_device *); void __thermal_cdev_update(struct thermal_cooling_device *cdev); =20 -int get_tz_trend(struct thermal_zone_device *tz, int trip); +int get_tz_trend(struct thermal_zone_device *tz, int trip_index); =20 struct thermal_instance * get_thermal_instance(struct thermal_zone_device *tz, Index: linux-pm/drivers/thermal/thermal_helpers.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/thermal/thermal_helpers.c +++ linux-pm/drivers/thermal/thermal_helpers.c @@ -22,8 +22,9 @@ #include "thermal_core.h" #include "thermal_trace.h" =20 -int get_tz_trend(struct thermal_zone_device *tz, int trip) +int get_tz_trend(struct thermal_zone_device *tz, int trip_index) { + struct thermal_trip *trip =3D tz->trips ? &tz->trips[trip_index] : NULL; enum thermal_trend trend; =20 if (tz->emul_temperature || !tz->ops->get_trend || Index: linux-pm/drivers/thermal/ti-soc-thermal/ti-thermal-common.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/thermal/ti-soc-thermal/ti-thermal-common.c +++ linux-pm/drivers/thermal/ti-soc-thermal/ti-thermal-common.c @@ -109,7 +109,8 @@ static inline int __ti_thermal_get_temp( return ret; } =20 -static int __ti_thermal_get_trend(struct thermal_zone_device *tz, int trip= , enum thermal_trend *trend) +static int __ti_thermal_get_trend(struct thermal_zone_device *tz, + struct thermal_trip *trip, enum thermal_trend *trend) { struct ti_thermal_data *data =3D thermal_zone_device_priv(tz); struct ti_bandgap *bgp;