From nobody Sun Feb 8 11:32:24 2026 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 4B8B614600C; Fri, 29 Nov 2024 16:28:26 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=79.96.170.134 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1732897710; cv=none; b=hsVqN6T5QJmJaR4lEtJ9NxiFUN0JLnPUQrI1+RUfIMGG3lFxPqoPPcv720dLUV86zA7dNDi4RjeYxowdzij7OKACcHeCbz6c7XYbxED4Ar0+OhkRLmJ0QoiGXrgbeEpfeT215d432hwGLHLMi0dvL3zPSj7d1W+YIoejLBJlmj8= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1732897710; c=relaxed/simple; bh=IWjmn1yIhP+LrnlCgE1nt0YBoOITdeu5KNHqPaIxTUs=; h=From:To:Cc:Subject:Date:Message-ID:In-Reply-To:References: MIME-Version:Content-Type; b=HbJtVafEWW88xrRZnBxuN/xfETyff2v+sXw/KYk4ZLlV+2OB7dnk/03iD9WFnwyiPzooPClgG5KDzDSJyDf0y0/3YMeObxKlVIYM04fy5sNnzdKN6RAHILfxQrdV82eS3SlZbGvb7vK5QeOkoK5VrfIPdSdXTBDhnJnb9XReBR0= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net; spf=pass smtp.mailfrom=rjwysocki.net; dkim=pass (2048-bit key) header.d=rjwysocki.net header.i=@rjwysocki.net header.b=SXIhg6v/; arc=none smtp.client-ip=79.96.170.134 Authentication-Results: smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=rjwysocki.net header.i=@rjwysocki.net header.b="SXIhg6v/" Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 6.2.1) id bec5d256e9aad60d; Fri, 29 Nov 2024 17:28:19 +0100 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by cloudserver094114.home.pl (Postfix) with ESMTPSA id CDDE1A47B8B; Fri, 29 Nov 2024 17:28:18 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=rjwysocki.net; s=dkim; t=1732897699; bh=IWjmn1yIhP+LrnlCgE1nt0YBoOITdeu5KNHqPaIxTUs=; h=From:Subject:Date; b=SXIhg6v/vEeNjGzbYz1zWFdGfGW2lEflOMBkI7TfnRd1CRnZhuOfnspfkLa3RDXWj m5wzGQ+l+W7fnvg4i7y/v4DDFT3NzqgIcQlDhcWWOyDWWuQBQuS+HAUoS0oR9yeRyQ ChD1vyMQafRTcCIIvJ3xK2Afg9HQ4TjoBIZH+daLJTytdW1YklogmsKiZ7dmf+lmLj Z/QAxUyxAtwL8SV0AUlDrDwNsFheKHwI3702KD+evPHiU40PrRzSAHqXGifY93nrgr fg+LlyniZf89db84dzBY14Jt/ZO4pExipx3qxes9ssxfaqJvl1I2agkd9smZ1o3g0K uwbBJb4rDC3KA== From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Lukasz Luba , Peter Zijlstra , Srinivas Pandruvada , Dietmar Eggemann , Morten Rasmussen , Vincent Guittot , Ricardo Neri , Pierre Gondois Subject: [RFC][PATCH v021 9/9] cpufreq: intel_pstate: Add basic EAS support on hybrid platforms Date: Fri, 29 Nov 2024 17:28:12 +0100 Message-ID: <4414387.ejJDZkT8p0@rjwysocki.net> In-Reply-To: <5861970.DvuYhMxLoT@rjwysocki.net> References: <5861970.DvuYhMxLoT@rjwysocki.net> Precedence: bulk X-Mailing-List: linux-kernel@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeefuddrheefgdekjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpeefudduuedtuefgleffudeigeeitdeufeelvdejgefftdethffhhfethfeljefgteenucffohhmrghinhepkhgvrhhnvghlrdhorhhgnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomheprhhjfiesrhhjfiihshhotghkihdrnhgvthdpnhgspghrtghpthhtohepuddtpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhukhgrshiirdhluhgsrgesrghrmhdrtghomhdprhgtphhtthhopehpvghtvghriiesihhnfhhrrgguvggrugdrohhrghdprhgtphhtthhopehsrhhinhhivhgrshdrphg X-DCC--Metrics: v370.home.net.pl 1024; Body=10 Fuz1=10 Fuz2=10 Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki Modify intel_pstate to register EM perf domains for hybrid domains, introduced previously, via em_dev_register_perf_domain(), and to use em_dev_expand_perf_domain(), also introduced previously, for adding new CPUs to existing EM perf domains when those CPUs become online for the first time after driver initialization. This change is targeting platforms (for example, Lunar Lake) where the "little" CPUs (E-cores) are always more energy-efficient than the "big" or "performance" CPUs (P-cores) when run at the same HWP performance level, so it is sufficient to tell EAS that E-cores are always preferred (so long as there is enough spare capacity on one of them to run the given task). Accordingly, an EM perf domain with 1-element states array is registered for each hybrid domain in the system and each of them is assigned a single cost value. The observation used here is that the IPC ratio between the CPUs in a given hybrid domain is inversely proportional to their performance-to- frequency scaling factor (which must be the same for all of them) and the cost of running on one of them can be assumed to be proportional to that IPC ratio (in principle, the higher the IPC ratio, the more resources are utilized when running at a given frequency, so the cost should be higher). EM perf domains for all CPUs that are online during system startup are registered at the driver initialization time, after asymmetric capacity support has been enabled. For the CPUs that become online later and do not belong to any existing hybrid domain, an EM perf domain is registered when the hybrid domain for the given CPU is created. Signed-off-by: Rafael J. Wysocki --- v0.1 -> v0.2: * Some changes have been dropped because patch [8/9] takes care of what they did now. * Some corner cases related to changing driver operation modes are now handled. For now, I'm sticking to the idea of having one "effective OPP" per EM perf domain because (a) it should be sufficient for the target use case IIUC and (b) anything more complex would need to be tied to the capacity updates carried out by intel_pstate and that would be a much heavier lifting. Besides, I'd generally prefer to avoid updating the energy model on every CPU capacity update because that might need to happen too often. If my understanding of this thread is correct: https://lore.kernel.org/lkml/20240830130309.2141697-1-vincent.guittot@linar= o.org/ if there is only one "OPP" per perf domain, within a perf domain EAS will look for a CPU with the highest spare capacity which is exactly what I want and it will generally prefer domains with the lower cost values. So far, I'm not aware of any upcoming hybrid platforms with significant cross-over points between power-performance curves for different types of CPUs, so the current approach (possibly with the addition of some kind of load balancing) should be sufficient for them. If such cross-over points become an issue the future, more complete energy models will need to be used for systems where they are present, but that will require solving the problem with scaling the performance numbers in the states table to the current CPU capacity at init time. --- drivers/cpufreq/intel_pstate.c | 83 ++++++++++++++++++++++++++++++++++++= +++-- 1 file changed, 79 insertions(+), 4 deletions(-) Index: linux-pm/drivers/cpufreq/intel_pstate.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/cpufreq/intel_pstate.c +++ linux-pm/drivers/cpufreq/intel_pstate.c @@ -950,12 +950,67 @@ static DEFINE_MUTEX(hybrid_capacity_lock */ struct hybrid_domain { struct hybrid_domain *next; + struct device *dev; cpumask_t cpumask; int scaling; }; =20 static struct hybrid_domain *hybrid_domains; =20 +static int hybrid_get_cost(struct device *dev, unsigned long freq_not_used, + unsigned long *cost) +{ + struct pstate_data *pd =3D &all_cpu_data[dev->id]->pstate; + + /* + * The smaller the perf-to-frequency scaling factor, the larger the IPC + * ratio between the CPUs in the given domain and the least capable CPU + * in the system. Assume the cost to be proportional to that IPC ratio + * (and note that perf_ctl_scaling is always the same for all CPUs in + * the system and it is equal to the perf-to-frequency scaling factor + * for one CPU type). + */ + *cost =3D div_u64(100ULL * pd->perf_ctl_scaling, pd->scaling); + + return 0; +} + +static bool hybrid_register_perf_domain(struct hybrid_domain *hd) +{ + static struct em_data_callback em_cb =3D EM_ADV_DATA_CB(NULL, hybrid_get_= cost); + + /* + * Registering EM perf domains without enabling asymmetric CPU capacity + * support is not really useful and one domain should not be registered + * more than once. + */ + if (!hybrid_max_perf_cpu || hd->dev) + return false; + + hd->dev =3D get_cpu_device(cpumask_any(&hd->cpumask)); + if (!hd->dev) + return false; + + /* + * Use one EM state in each domain to indicate that the cost associated + * with it applies to all CPUs in it regardless of the frequency. + */ + if (em_dev_register_perf_domain(hd->dev, 1, &em_cb, &hd->cpumask, false))= { + hd->dev =3D NULL; + return false; + } + + return true; +} + +static void hybrid_register_all_perf_domains(void) +{ + struct hybrid_domain *hd; + + for (hd =3D hybrid_domains; hd; hd =3D hd->next) + hybrid_register_perf_domain(hd); +} + static void hybrid_add_to_domain(struct cpudata *cpudata) { int scaling =3D cpudata->pstate.scaling; @@ -975,6 +1030,8 @@ static void hybrid_add_to_domain(struct return; =20 cpumask_set_cpu(cpu, &hd->cpumask); + if (hd->dev) + em_dev_expand_perf_domain(hd->dev, cpu); =20 pr_debug("CPU %d added to hybrid domain %*pbl\n", cpu, cpumask_pr_args(&hd->cpumask)); @@ -991,11 +1048,14 @@ static void hybrid_add_to_domain(struct hd->scaling =3D scaling; hd->next =3D hybrid_domains; hybrid_domains =3D hd; + if (hybrid_register_perf_domain(hd)) + em_rebuild_perf_domains(); =20 pr_debug("New hybrid domain %*pbl: scaling =3D %d\n", cpumask_pr_args(&hd->cpumask), hd->scaling); } #else /* CONFIG_ENERGY_MODEL */ +static inline void hybrid_register_all_perf_domains(void) {} static inline void hybrid_add_to_domain(struct cpudata *cpudata) {} #endif /* !CONFIG_ENERGY_MODEL */ =20 @@ -1093,6 +1153,11 @@ static void hybrid_refresh_cpu_capacity_ guard(mutex)(&hybrid_capacity_lock); =20 __hybrid_refresh_cpu_capacity_scaling(); + /* + * Perf domains are not registered before setting hybrid_max_perf_cpu, + * so register them all after setting up CPU capacity scaling. + */ + hybrid_register_all_perf_domains(); } =20 static void hybrid_init_cpu_capacity_scaling(bool refresh) @@ -1116,7 +1181,7 @@ static void hybrid_init_cpu_capacity_sca hybrid_refresh_cpu_capacity_scaling(); /* * Disabling ITMT causes sched domains to be rebuilt to disable asym - * packing and enable asym capacity. + * packing and enable asym capacity and EAS. */ sched_clear_itmt_support(); } @@ -3467,6 +3532,8 @@ static ssize_t intel_pstate_show_status( =20 static int intel_pstate_update_status(const char *buf, size_t size) { + int ret =3D -EINVAL; + if (size =3D=3D 3 && !strncmp(buf, "off", size)) { if (!intel_pstate_driver) return -EINVAL; @@ -3476,6 +3543,8 @@ static int intel_pstate_update_status(co =20 cpufreq_unregister_driver(intel_pstate_driver); intel_pstate_driver_cleanup(); + /* Trigger EAS support reconfiguration in case it was used. */ + rebuild_sched_domains_energy(); return 0; } =20 @@ -3487,7 +3556,13 @@ static int intel_pstate_update_status(co cpufreq_unregister_driver(intel_pstate_driver); } =20 - return intel_pstate_register_driver(&intel_pstate); + ret =3D intel_pstate_register_driver(&intel_pstate); + /* + * If the previous status had been "passive" and the schedutil + * governor had been used, it disabled EAS on exit, so trigger + * sched domains rebuild in case EAS needs to be enabled again. + */ + rebuild_sched_domains_energy(); } =20 if (size =3D=3D 7 && !strncmp(buf, "passive", size)) { @@ -3499,10 +3574,10 @@ static int intel_pstate_update_status(co intel_pstate_sysfs_hide_hwp_dynamic_boost(); } =20 - return intel_pstate_register_driver(&intel_cpufreq); + ret =3D intel_pstate_register_driver(&intel_cpufreq); } =20 - return -EINVAL; + return ret; } =20 static int no_load __initdata;