From nobody Sat Feb 7 16:49:55 2026 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 4FDF2C001DE for ; Mon, 7 Aug 2023 18:21:05 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S229719AbjHGSVE (ORCPT ); Mon, 7 Aug 2023 14:21:04 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:53312 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229804AbjHGSU6 (ORCPT ); Mon, 7 Aug 2023 14:20:58 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 49610DE; Mon, 7 Aug 2023 11:20:56 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 8cfedfee9a03d93a; Mon, 7 Aug 2023 20:20:54 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id EBE836625B2; Mon, 7 Aug 2023 20:20:53 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v5 10/11] ACPI: thermal: Drop unnecessary thermal zone callbacks Date: Mon, 07 Aug 2023 20:18:49 +0200 Message-ID: <3436224.QJadu78ljV@kreacher> In-Reply-To: <4503814.LvFx2qVVIh@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4503814.LvFx2qVVIh@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrledtgdduudejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki Drop the .get_trip_type(), .get_trip_temp() and .get_crit_temp() thermal zone callbacks that are not necessary any more from the ACPI thermal driver along with the corresponding callback functions. Signed-off-by: Rafael J. Wysocki --- v4 -> v5: Rebase. v3 -> v4: No changes. v2 -> v3: Rebase on top of the v2 of the previous patch. v1 -> v2: No changes. --- drivers/acpi/thermal.c | 115 --------------------------------------------= ----- 1 file changed, 115 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -484,118 +484,6 @@ static int thermal_get_temp(struct therm return 0; } =20 -static int thermal_get_trip_type(struct thermal_zone_device *thermal, - int trip, enum thermal_trip_type *type) -{ - struct acpi_thermal *tz =3D thermal_zone_device_priv(thermal); - int i; - - if (!tz || trip < 0) - return -EINVAL; - - if (tz->trips.critical.valid) { - if (!trip) { - *type =3D THERMAL_TRIP_CRITICAL; - return 0; - } - trip--; - } - - if (tz->trips.hot.valid) { - if (!trip) { - *type =3D THERMAL_TRIP_HOT; - return 0; - } - trip--; - } - - if (tz->trips.passive.trip.valid) { - if (!trip) { - *type =3D THERMAL_TRIP_PASSIVE; - return 0; - } - trip--; - } - - for (i =3D 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].trip.val= id; i++) { - if (!trip) { - *type =3D THERMAL_TRIP_ACTIVE; - return 0; - } - trip--; - } - - return -EINVAL; -} - -static int thermal_get_trip_temp(struct thermal_zone_device *thermal, - int trip, int *temp) -{ - struct acpi_thermal *tz =3D thermal_zone_device_priv(thermal); - int i; - - if (!tz || trip < 0) - return -EINVAL; - - if (tz->trips.critical.valid) { - if (!trip) { - *temp =3D deci_kelvin_to_millicelsius_with_offset( - tz->trips.critical.temperature, - tz->kelvin_offset); - return 0; - } - trip--; - } - - if (tz->trips.hot.valid) { - if (!trip) { - *temp =3D deci_kelvin_to_millicelsius_with_offset( - tz->trips.hot.temperature, - tz->kelvin_offset); - return 0; - } - trip--; - } - - if (tz->trips.passive.trip.valid) { - if (!trip) { - *temp =3D deci_kelvin_to_millicelsius_with_offset( - tz->trips.passive.trip.temperature, - tz->kelvin_offset); - return 0; - } - trip--; - } - - for (i =3D 0; i < ACPI_THERMAL_MAX_ACTIVE && - tz->trips.active[i].trip.valid; i++) { - if (!trip) { - *temp =3D deci_kelvin_to_millicelsius_with_offset( - tz->trips.active[i].trip.temperature, - tz->kelvin_offset); - return 0; - } - trip--; - } - - return -EINVAL; -} - -static int thermal_get_crit_temp(struct thermal_zone_device *thermal, - int *temperature) -{ - struct acpi_thermal *tz =3D thermal_zone_device_priv(thermal); - - if (tz->trips.critical.valid) { - *temperature =3D deci_kelvin_to_millicelsius_with_offset( - tz->trips.critical.temperature, - tz->kelvin_offset); - return 0; - } - - return -EINVAL; -} - static int thermal_get_trend(struct thermal_zone_device *thermal, int trip_index, enum thermal_trend *trend) { @@ -758,9 +646,6 @@ static struct thermal_zone_device_ops ac .bind =3D acpi_thermal_bind_cooling_device, .unbind =3D acpi_thermal_unbind_cooling_device, .get_temp =3D thermal_get_temp, - .get_trip_type =3D thermal_get_trip_type, - .get_trip_temp =3D thermal_get_trip_temp, - .get_crit_temp =3D thermal_get_crit_temp, .get_trend =3D thermal_get_trend, .hot =3D acpi_thermal_zone_device_hot, .critical =3D acpi_thermal_zone_device_critical,