From nobody Mon Feb 9 15:26:56 2026 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 99DA6C04A6A for ; Fri, 4 Aug 2023 21:26:17 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231174AbjHDV0P (ORCPT ); Fri, 4 Aug 2023 17:26:15 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:44034 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230208AbjHDV0J (ORCPT ); Fri, 4 Aug 2023 17:26:09 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id B1052E46; Fri, 4 Aug 2023 14:26:07 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 82f67363ccf29e27; Fri, 4 Aug 2023 23:26:06 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 8B747661680; Fri, 4 Aug 2023 23:26:05 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v4 08/10] ACPI: thermal: Rework thermal_get_trend() Date: Fri, 04 Aug 2023 23:22:57 +0200 Message-ID: <23199624.6Emhk5qWAg@kreacher> In-Reply-To: <4878513.31r3eYUQgx@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4878513.31r3eYUQgx@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkeeggdduheelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki Rework the ACPI thermal driver's .get_trend() callback function, thermal_get_trend(), so that it does not call thermal_get_trip_type() and thermal_get_trip_temp() which are going to be dropped. This reduces the overhead of the function too, because it will always carry out a trip point lookup once after the change. Signed-off-by: Rafael J. Wysocki --- v3 -> v4: * Adjust for the lack of a direct way to get from the local trip point representations to trips[i]. v2 -> v3: Rebase on top of the v2 of the previous patch. v1 -> v2: * Do not acquire thermal_check_lock in thermal_get_trend() (lockdep would complain about this, because it is hold around thermal zone locking and .get_trend() runs under the thermal zone lock). The thermal zone locking added in the previous patches is sufficient to protect this code. * Check trips against invalid temperature values. * Return an error for trips other than passive and active. --- drivers/acpi/thermal.c | 68 +++++++++++++++++++++++++++-----------------= ----- 1 file changed, 38 insertions(+), 30 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -616,46 +616,54 @@ static int thermal_get_crit_temp(struct } =20 static int thermal_get_trend(struct thermal_zone_device *thermal, - int trip, enum thermal_trend *trend) + int trip_index, enum thermal_trend *trend) { struct acpi_thermal *tz =3D thermal_zone_device_priv(thermal); - enum thermal_trip_type type; - int i; + int t, i; =20 - if (thermal_get_trip_type(thermal, trip, &type)) + if (!tz || trip_index < 0) return -EINVAL; =20 - if (type =3D=3D THERMAL_TRIP_ACTIVE) { - int trip_temp; - int temp =3D deci_kelvin_to_millicelsius_with_offset( - tz->temperature, tz->kelvin_offset); - if (thermal_get_trip_temp(thermal, trip, &trip_temp)) - return -EINVAL; + if (tz->trips.critical.valid) + trip_index--; =20 - if (temp > trip_temp) { + if (tz->trips.hot.valid) + trip_index--; + + if (trip_index < 0) + return -EINVAL; + + if (tz->trips.passive.valid && !trip_index--) { + t =3D tz->trips.passive.tc1 * (tz->temperature - + tz->last_temperature) + + tz->trips.passive.tc2 * (tz->temperature - + tz->trips.passive.temperature); + if (t > 0) *trend =3D THERMAL_TREND_RAISING; - return 0; - } else { - /* Fall back on default trend */ - return -EINVAL; - } + else if (t < 0) + *trend =3D THERMAL_TREND_DROPPING; + else + *trend =3D THERMAL_TREND_STABLE; + + return 0; } =20 - /* - * tz->temperature has already been updated by generic thermal layer, - * before this callback being invoked - */ - i =3D tz->trips.passive.tc1 * (tz->temperature - tz->last_temperature) + - tz->trips.passive.tc2 * (tz->temperature - tz->trips.passive.temperat= ure); - - if (i > 0) - *trend =3D THERMAL_TREND_RAISING; - else if (i < 0) - *trend =3D THERMAL_TREND_DROPPING; - else - *trend =3D THERMAL_TREND_STABLE; + t =3D acpi_thermal_temp(tz, tz->temperature); + + for (i =3D 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { + if (tz->trips.active[i].valid && !trip_index--) { + int trip_temp; + + trip_temp =3D acpi_thermal_temp(tz, tz->trips.active[i].temperature); + if (t > trip_temp) { + *trend =3D THERMAL_TREND_RAISING; + return 0; + } + break; + } + } =20 - return 0; + return -EINVAL; } =20 static void acpi_thermal_zone_device_hot(struct thermal_zone_device *therm= al)