From nobody Mon Feb 9 17:55:20 2026 Received: from fout-b4-smtp.messagingengine.com (fout-b4-smtp.messagingengine.com [202.12.124.147]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 282212E2838; Sun, 14 Sep 2025 19:39:01 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=202.12.124.147 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1757878749; cv=none; b=EluWvb9wyaoqM0lvynTNZcVdW3Rj6fu7orYf2pcKM9w5A+GU/0FsHV19IZIzuBpl3/A5HddYUPpPdrbfv4FFwFTDIYiK0cnskrSF+t+bWrHuK+jzpqoSdZB/Yu/mrLUjUAonyeVpbIEVQdF/T6dhPoxVyxaYS0HWFO5TPOMbYZs= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1757878749; c=relaxed/simple; bh=QapEX0xK574gOyzSo6I94kNsXh0SsMSk3gHmvVMVmI8=; h=From:Date:Subject:MIME-Version:Content-Type:Message-Id:References: In-Reply-To:To:Cc; b=m1ItxOrN5rm+0lhohjL3s6P7Ib9FMu4YQ+QfT2TJJFy7IPlqoSPQjDyW0aNVICEGNxcSmqWedySn9JbWS+pajak8YyYjmABW2+G47XvGiJKn923Wr6PId2PEZB1xQAfVvbHLvew+BF0aJleI6O4OhmSbk1CgYtgzCy4LPWJQe4c= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=jannau.net; spf=pass smtp.mailfrom=jannau.net; dkim=pass (2048-bit key) header.d=jannau.net header.i=@jannau.net header.b=MVhJ9Zi1; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b=JVeSgWne; arc=none smtp.client-ip=202.12.124.147 Authentication-Results: smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=jannau.net Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=jannau.net Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=jannau.net header.i=@jannau.net header.b="MVhJ9Zi1"; dkim=pass (2048-bit key) header.d=messagingengine.com header.i=@messagingengine.com header.b="JVeSgWne" Received: from phl-compute-05.internal (phl-compute-05.internal [10.202.2.45]) by mailfout.stl.internal (Postfix) with ESMTP id 05A421D00106; Sun, 14 Sep 2025 15:39:00 -0400 (EDT) Received: from phl-mailfrontend-02 ([10.202.2.163]) by phl-compute-05.internal (MEProxy); Sun, 14 Sep 2025 15:39:01 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=jannau.net; h=cc :cc:content-transfer-encoding:content-type:content-type:date :date:from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to; s=fm3; t=1757878740; x=1757965140; bh=GFz5YXm+QBgPEwA6OXNW+qzwp1qke4J/9HVFqwv6uas=; b= MVhJ9Zi1QJd1FCjGaefp7ITtRFHwvVJ8OEjHETe9QsZT7R0FZDIFRuEKNMXnLmiX efUe31L9u2yDulnfg/212AZ3ISaSyJbuz/gcqehkPUK/YpwjXJU4xtu4QVf/AobI 1/TNO0tcbqNm8gvdVwgbKU9RWsQC09OjEk357gZEeaq5y9NFXlDumxG04obt76Dg myx5RGQVUooz0kTkilHySc7o2fl/yLe+tvpPrfVhUczT0hzYamKvCBfwmbLnZ7LJ f0lZbb4G0m06RKBkHLgmdkDfT5H5LK2LN/99otYqeNkWFSnRKy7YEcmZ60plq3Pb o60eeMqzSe3Wau32jFomuQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm1; t=1757878740; x= 1757965140; bh=GFz5YXm+QBgPEwA6OXNW+qzwp1qke4J/9HVFqwv6uas=; b=J VeSgWneRfdyfY+DZyIEj34n9qEhpn/rc+0+NVEG351utVRh5LWCZIDmXV1d+j5BA PcD4E4ZR5MZBNSg+yFinCHm5qrTVVoXjJtNRzdFRrYshXG/4N6iDeSY/GfZUI+yC exeVcDAyFVZf3GoAF9zPQY7fzI8dwIsaPTT5+Lm1neihtNd8KI2PDIRLWfH36P4R LzXljcXrvL/1utMzuHuxGlhGz0ht2xr6/UcV1sv+6+GPYrsrWDTcoQGeZMEAaahJ 99bvu+bCAfVoFDzHrlt0OO52R89d17p40aBz0y13lS/3U0DpzvP2hnXl2VmH4GXo SBBpVPsEd498K0X15qDMA== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtdeggdefheeijecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpuffrtefokffrpgfnqfghnecuuegr ihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjug hrpefhfffugggtgffkfhgjvfevofesthejredtredtjeenucfhrhhomheplfgrnhhnvgcu ifhruhhnrghuuceojhesjhgrnhhnrghurdhnvghtqeenucggtffrrghtthgvrhhnpeefhe ehieeludffheetiefhvddtleffuddtleduudeiudetvdefffehkeehgfettdenucevlhhu shhtvghrufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpehjsehjrghnnhgruh drnhgvthdpnhgspghrtghpthhtohepudefpdhmohguvgepshhmthhpohhuthdprhgtphht thhopehrohgshheskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepnhgvrghlsehgohhmph grrdguvghvpdhrtghpthhtohepjhesjhgrnhhnrghurdhnvghtpdhrtghpthhtoheprghs rghhiheslhhishhtshdrlhhinhhugidruggvvhdprhgtphhtthhopehlihhnuhigqdgrrh hmqdhkvghrnhgvlheslhhishhtshdrihhnfhhrrgguvggrugdrohhrghdprhgtphhtthho pehmrgiisehkvghrnhgvlhdrohhrghdprhgtphhtthhopehsvhgvnheskhgvrhhnvghlrd horhhgpdhrtghpthhtohepuggvvhhitggvthhrvggvsehvghgvrhdrkhgvrhhnvghlrdho rhhgpdhrtghpthhtoheprghlhihsshgrsehrohhsvghniiifvghighdrihho X-ME-Proxy: Feedback-ID: i47b949f6:Fastmail Received: by mail.messagingengine.com (Postfix) with ESMTPA; Sun, 14 Sep 2025 15:38:59 -0400 (EDT) From: Janne Grunau Date: Sun, 14 Sep 2025 21:38:46 +0200 Subject: [PATCH v2 3/6] arm64: dts: apple: Add initial t6020/t6021/t6022 DTs Precedence: bulk X-Mailing-List: linux-kernel@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Message-Id: <20250914-dt-apple-t6020-v2-3-1a738a98bb43@jannau.net> References: <20250914-dt-apple-t6020-v2-0-1a738a98bb43@jannau.net> In-Reply-To: <20250914-dt-apple-t6020-v2-0-1a738a98bb43@jannau.net> To: Sven Peter , Janne Grunau , Alyssa Rosenzweig , Neal Gompa , Rob Herring , Krzysztof Kozlowski , Conor Dooley , Hector Martin , Marc Zyngier Cc: asahi@lists.linux.dev, linux-arm-kernel@lists.infradead.org, devicetree@vger.kernel.org, linux-kernel@vger.kernel.org X-Mailer: b4 0.14.2 X-Developer-Signature: v=1; a=openpgp-sha256; l=123509; i=j@jannau.net; s=yk2025; h=from:subject:message-id; bh=7s3LDTDbvBtZ3eJqO6TM9KGKWpwZuL/YNqxjbL/TOfI=; b=owGbwMvMwCW2UNrmdq9+ahrjabUkhozjkqfu/LzKWMBntkTEhK3yoGnSuZzC6ctKWC5NvRSxv Th02qSNHaUsDGJcDLJiiixJ2i87GFbXKMbUPgiDmcPKBDKEgYtTACayQpThn8o5o8cHL6yfOjOo MXW9lhJrsk2/l7eXX2WV3oIcJfmPDgx/+P6JumkUy7yfLXTwhvqr9xPWbdqSn/95nsjUx9Yywp9 0OQE= X-Developer-Key: i=j@jannau.net; a=openpgp; fpr=8B336A6BE4E5695E89B8532B81E806F586338419 From: Hector Martin These SoCs are found in Apple devices with M2 Pro (t6020), M2 Max (t6021) and M2 Ultra (t6022) and follow the pattern of their M1 counterparts. t6020 is a cut-down version of t6021, so the former just includes the latter and disables the missing bits (This is currently just one PMGR node and all of its domains. t6022 is two connected t6021 dies. The implementation seems to use t6021 with blocks disabled (mostly on the second die). MMIO addresses on the second die have a constant offset. The interrupt controller is multi-die aware. This setup can be represented in the device tree with two top level "soc" nodes. The MMIO offset is applied via "ranges" and devices are included with preproceesor macros to make the node labels unique and to specify the die number for the interrupt definition. Device nodes are distributed over dtsi files based on whether they are present on both dies or just on the first die. The only exception is the NVMe controller which resides on the second die. Its nodes are in a separate file. Signed-off-by: Hector Martin Reviewed-by: Neal Gompa Co-developed-by: Janne Grunau Signed-off-by: Janne Grunau --- arch/arm64/boot/dts/apple/t6020.dtsi | 22 + arch/arm64/boot/dts/apple/t6021.dtsi | 69 + arch/arm64/boot/dts/apple/t6022.dtsi | 349 ++++ arch/arm64/boot/dts/apple/t602x-common.dtsi | 465 +++++ arch/arm64/boot/dts/apple/t602x-die0.dtsi | 575 ++++++ arch/arm64/boot/dts/apple/t602x-dieX.dtsi | 128 ++ arch/arm64/boot/dts/apple/t602x-gpio-pins.dtsi | 81 + arch/arm64/boot/dts/apple/t602x-nvme.dtsi | 42 + arch/arm64/boot/dts/apple/t602x-pmgr.dtsi | 2265 ++++++++++++++++++++= ++++ 9 files changed, 3996 insertions(+) diff --git a/arch/arm64/boot/dts/apple/t6020.dtsi b/arch/arm64/boot/dts/app= le/t6020.dtsi new file mode 100644 index 0000000000000000000000000000000000000000..bffa66a3ffff3fea9e980f2a31f= 2bf87da9d7bfd --- /dev/null +++ b/arch/arm64/boot/dts/apple/t6020.dtsi @@ -0,0 +1,22 @@ +// SPDX-License-Identifier: GPL-2.0+ OR MIT +/* + * Apple T6020 "M2 Pro" SoC + * + * Other names: H14J, "Rhodes Chop" + * + * Copyright The Asahi Linux Contributors + */ + +/* This chip is just a cut down version of t6021, so include it and disabl= e the missing parts */ + +#include "t6021.dtsi" + +/ { + compatible =3D "apple,t6020", "apple,arm-platform"; +}; + +/delete-node/ &pmgr_south; + +&gpu { + compatible =3D "apple,agx-g14s"; +}; diff --git a/arch/arm64/boot/dts/apple/t6021.dtsi b/arch/arm64/boot/dts/app= le/t6021.dtsi new file mode 100644 index 0000000000000000000000000000000000000000..62907ad6a546836676952edd324= 8f3388cb480e4 --- /dev/null +++ b/arch/arm64/boot/dts/apple/t6021.dtsi @@ -0,0 +1,69 @@ +// SPDX-License-Identifier: GPL-2.0+ OR MIT +/* + * Apple T6021 "M2 Max" SoC + * + * Other names: H14J, "Rhodes" + * + * Copyright The Asahi Linux Contributors + */ + +#include +#include +#include +#include +#include +#include + +#include "multi-die-cpp.h" + +#include "t602x-common.dtsi" + +/ { + compatible =3D "apple,t6021", "apple,arm-platform"; + + soc { + compatible =3D "simple-bus"; + #address-cells =3D <2>; + #size-cells =3D <2>; + + ranges; + nonposted-mmio; + + // filled via templated includes at the end of the file + }; +}; + +#define DIE +#define DIE_NO 0 + +&{/soc} { + #include "t602x-die0.dtsi" + #include "t602x-dieX.dtsi" + #include "t602x-nvme.dtsi" +}; + +#include "t602x-gpio-pins.dtsi" +#include "t602x-pmgr.dtsi" + +#undef DIE +#undef DIE_NO + + +&aic { + affinities { + e-core-pmu-affinity { + apple,fiq-index =3D ; + cpus =3D <&cpu_e00 &cpu_e01 &cpu_e02 &cpu_e03>; + }; + + p-core-pmu-affinity { + apple,fiq-index =3D ; + cpus =3D <&cpu_p00 &cpu_p01 &cpu_p02 &cpu_p03 + &cpu_p10 &cpu_p11 &cpu_p12 &cpu_p13>; + }; + }; +}; + +&gpu { + compatible =3D "apple,agx-g14c", "apple,agx-g14s"; +}; diff --git a/arch/arm64/boot/dts/apple/t6022.dtsi b/arch/arm64/boot/dts/app= le/t6022.dtsi new file mode 100644 index 0000000000000000000000000000000000000000..e73bf2f7510ae2e840b3607d888= 09757ead51164 --- /dev/null +++ b/arch/arm64/boot/dts/apple/t6022.dtsi @@ -0,0 +1,349 @@ +// SPDX-License-Identifier: GPL-2.0+ OR MIT +/* + * Apple T6022 "M2 Ultra" SoC + * + * Other names: H14J, "Rhodes 2C" + * + * Copyright The Asahi Linux Contributors + */ + +#include +#include +#include +#include +#include +#include + +#include "multi-die-cpp.h" + +#include "t602x-common.dtsi" + +/ { + compatible =3D "apple,t6022", "apple,arm-platform"; + + #address-cells =3D <2>; + #size-cells =3D <2>; + + cpus { + cpu-map { + cluster3 { + core0 { + cpu =3D <&cpu_e10>; + }; + core1 { + cpu =3D <&cpu_e11>; + }; + core2 { + cpu =3D <&cpu_e12>; + }; + core3 { + cpu =3D <&cpu_e13>; + }; + }; + + cluster4 { + core0 { + cpu =3D <&cpu_p20>; + }; + core1 { + cpu =3D <&cpu_p21>; + }; + core2 { + cpu =3D <&cpu_p22>; + }; + core3 { + cpu =3D <&cpu_p23>; + }; + }; + + cluster5 { + core0 { + cpu =3D <&cpu_p30>; + }; + core1 { + cpu =3D <&cpu_p31>; + }; + core2 { + cpu =3D <&cpu_p32>; + }; + core3 { + cpu =3D <&cpu_p33>; + }; + }; + }; + + cpu_e10: cpu@800 { + compatible =3D "apple,blizzard"; + device_type =3D "cpu"; + reg =3D <0x0 0x800>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* to be filled by loader */ + next-level-cache =3D <&l2_cache_3>; + i-cache-size =3D <0x20000>; + d-cache-size =3D <0x10000>; + operating-points-v2 =3D <&blizzard_opp>; + capacity-dmips-mhz =3D <756>; + performance-domains =3D <&cpufreq_e_die1>; + }; + + cpu_e11: cpu@801 { + compatible =3D "apple,blizzard"; + device_type =3D "cpu"; + reg =3D <0x0 0x801>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* to be filled by loader */ + next-level-cache =3D <&l2_cache_3>; + i-cache-size =3D <0x20000>; + d-cache-size =3D <0x10000>; + operating-points-v2 =3D <&blizzard_opp>; + capacity-dmips-mhz =3D <756>; + performance-domains =3D <&cpufreq_e_die1>; + }; + + cpu_e12: cpu@802 { + compatible =3D "apple,blizzard"; + device_type =3D "cpu"; + reg =3D <0x0 0x802>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* to be filled by loader */ + next-level-cache =3D <&l2_cache_3>; + i-cache-size =3D <0x20000>; + d-cache-size =3D <0x10000>; + operating-points-v2 =3D <&blizzard_opp>; + capacity-dmips-mhz =3D <756>; + performance-domains =3D <&cpufreq_e_die1>; + }; + + cpu_e13: cpu@803 { + compatible =3D "apple,blizzard"; + device_type =3D "cpu"; + reg =3D <0x0 0x803>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* to be filled by loader */ + next-level-cache =3D <&l2_cache_3>; + i-cache-size =3D <0x20000>; + d-cache-size =3D <0x10000>; + operating-points-v2 =3D <&blizzard_opp>; + capacity-dmips-mhz =3D <756>; + performance-domains =3D <&cpufreq_e_die1>; + }; + + cpu_p20: cpu@10900 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10900>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_4>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p0_die1>; + }; + + cpu_p21: cpu@10901 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10901>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_4>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p0_die1>; + }; + + cpu_p22: cpu@10902 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10902>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_4>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p0_die1>; + }; + + cpu_p23: cpu@10903 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10903>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_4>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p0_die1>; + }; + + cpu_p30: cpu@10a00 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10a00>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_5>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p1_die1>; + }; + + cpu_p31: cpu@10a01 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10a01>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_5>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p1_die1>; + }; + + cpu_p32: cpu@10a02 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10a02>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_5>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p1_die1>; + }; + + cpu_p33: cpu@10a03 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10a03>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_5>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p1_die1>; + }; + + l2_cache_3: l2-cache-3 { + compatible =3D "cache"; + cache-level =3D <2>; + cache-unified; + cache-size =3D <0x400000>; + }; + + l2_cache_4: l2-cache-4 { + compatible =3D "cache"; + cache-level =3D <2>; + cache-unified; + cache-size =3D <0x1000000>; + }; + + l2_cache_5: l2-cache-5 { + compatible =3D "cache"; + cache-level =3D <2>; + cache-unified; + cache-size =3D <0x1000000>; + }; + }; + + die0: soc@200000000 { + compatible =3D "simple-bus"; + #address-cells =3D <2>; + #size-cells =3D <2>; + ranges =3D <0x02 0x00000000 0x02 0x00000000 0x4 0x00000000>, + <0x05 0x80000000 0x05 0x80000000 0x1 0x80000000>, + <0x07 0x00000000 0x07 0x00000000 0xf 0x80000000>, + <0x16 0x80000000 0x16 0x80000000 0x5 0x80000000>; + nonposted-mmio; + /* Required to get >32-bit DMA via DARTs */ + dma-ranges =3D <0 0 0 0 0xffffffff 0xffffc000>; + + // filled via templated includes at the end of the file + }; + + die1: soc@2200000000 { + compatible =3D "simple-bus"; + #address-cells =3D <2>; + #size-cells =3D <2>; + ranges =3D <0x02 0x00000000 0x22 0x00000000 0x4 0x00000000>, + <0x07 0x00000000 0x27 0x00000000 0xf 0x80000000>, + <0x16 0x80000000 0x36 0x80000000 0x5 0x80000000>; + nonposted-mmio; + /* Required to get >32-bit DMA via DARTs */ + dma-ranges =3D <0 0 0 0 0xffffffff 0xffffc000>; + + // filled via templated includes at the end of the file + }; +}; + +#define DIE +#define DIE_NO 0 + +&die0 { + #include "t602x-die0.dtsi" + #include "t602x-dieX.dtsi" +}; + +#include "t602x-pmgr.dtsi" +#include "t602x-gpio-pins.dtsi" + +#undef DIE +#undef DIE_NO + +#define DIE _die1 +#define DIE_NO 1 + +&die1 { + #include "t602x-dieX.dtsi" + #include "t602x-nvme.dtsi" +}; + +#include "t602x-pmgr.dtsi" + +/delete-node/ &ps_pmp_die1; + +#undef DIE +#undef DIE_NO + +&aic { + affinities { + e-core-pmu-affinity { + apple,fiq-index =3D ; + cpus =3D <&cpu_e00 &cpu_e01 &cpu_e02 &cpu_e03 + &cpu_e10 &cpu_e11 &cpu_e12 &cpu_e13>; + }; + + p-core-pmu-affinity { + apple,fiq-index =3D ; + cpus =3D <&cpu_p00 &cpu_p01 &cpu_p02 &cpu_p03 + &cpu_p10 &cpu_p11 &cpu_p12 &cpu_p13 + &cpu_p20 &cpu_p21 &cpu_p22 &cpu_p23 + &cpu_p30 &cpu_p31 &cpu_p32 &cpu_p33>; + }; + }; +}; + +&ps_gfx { + // On t6022, the die0 GPU power domain needs both AFR power domains + power-domains =3D <&ps_afr>, <&ps_afr_die1>; +}; + +&gpu { + compatible =3D "apple,agx-g14d", "apple,agx-g14s"; +}; diff --git a/arch/arm64/boot/dts/apple/t602x-common.dtsi b/arch/arm64/boot/= dts/apple/t602x-common.dtsi new file mode 100644 index 0000000000000000000000000000000000000000..9c800a391e7e87f86dce0f34c08= 276e69d2cb780 --- /dev/null +++ b/arch/arm64/boot/dts/apple/t602x-common.dtsi @@ -0,0 +1,465 @@ +// SPDX-License-Identifier: GPL-2.0+ OR MIT +/* + * Nodes common to all T602x family SoCs (M2 Pro/Max/Ultra) + * + * Other names: H14J, "Rhodes Chop", "Rhodes", "Rhodes 2C" + * + * Copyright The Asahi Linux Contributors + */ + +/ { + #address-cells =3D <2>; + #size-cells =3D <2>; + + aliases { + gpu =3D &gpu; + }; + + cpus { + #address-cells =3D <2>; + #size-cells =3D <0>; + + cpu-map { + cluster0 { + core0 { + cpu =3D <&cpu_e00>; + }; + core1 { + cpu =3D <&cpu_e01>; + }; + core2 { + cpu =3D <&cpu_e02>; + }; + core3 { + cpu =3D <&cpu_e03>; + }; + }; + + cluster1 { + core0 { + cpu =3D <&cpu_p00>; + }; + core1 { + cpu =3D <&cpu_p01>; + }; + core2 { + cpu =3D <&cpu_p02>; + }; + core3 { + cpu =3D <&cpu_p03>; + }; + }; + + cluster2 { + core0 { + cpu =3D <&cpu_p10>; + }; + core1 { + cpu =3D <&cpu_p11>; + }; + core2 { + cpu =3D <&cpu_p12>; + }; + core3 { + cpu =3D <&cpu_p13>; + }; + }; + }; + + cpu_e00: cpu@0 { + compatible =3D "apple,blizzard"; + device_type =3D "cpu"; + reg =3D <0x0 0x0>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* to be filled by loader */ + next-level-cache =3D <&l2_cache_0>; + i-cache-size =3D <0x20000>; + d-cache-size =3D <0x10000>; + operating-points-v2 =3D <&blizzard_opp>; + capacity-dmips-mhz =3D <756>; + performance-domains =3D <&cpufreq_e>; + }; + + cpu_e01: cpu@1 { + compatible =3D "apple,blizzard"; + device_type =3D "cpu"; + reg =3D <0x0 0x1>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* to be filled by loader */ + next-level-cache =3D <&l2_cache_0>; + i-cache-size =3D <0x20000>; + d-cache-size =3D <0x10000>; + operating-points-v2 =3D <&blizzard_opp>; + capacity-dmips-mhz =3D <756>; + performance-domains =3D <&cpufreq_e>; + }; + + cpu_e02: cpu@2 { + compatible =3D "apple,blizzard"; + device_type =3D "cpu"; + reg =3D <0x0 0x2>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* to be filled by loader */ + next-level-cache =3D <&l2_cache_0>; + i-cache-size =3D <0x20000>; + d-cache-size =3D <0x10000>; + operating-points-v2 =3D <&blizzard_opp>; + capacity-dmips-mhz =3D <756>; + performance-domains =3D <&cpufreq_e>; + }; + + cpu_e03: cpu@3 { + compatible =3D "apple,blizzard"; + device_type =3D "cpu"; + reg =3D <0x0 0x3>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* to be filled by loader */ + next-level-cache =3D <&l2_cache_0>; + i-cache-size =3D <0x20000>; + d-cache-size =3D <0x10000>; + operating-points-v2 =3D <&blizzard_opp>; + capacity-dmips-mhz =3D <756>; + performance-domains =3D <&cpufreq_e>; + }; + + cpu_p00: cpu@10100 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10100>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_1>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p0>; + }; + + cpu_p01: cpu@10101 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10101>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_1>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p0>; + }; + + cpu_p02: cpu@10102 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10102>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_1>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p0>; + }; + + cpu_p03: cpu@10103 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10103>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_1>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p0>; + }; + + cpu_p10: cpu@10200 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10200>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_2>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p1>; + }; + + cpu_p11: cpu@10201 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10201>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_2>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p1>; + }; + + cpu_p12: cpu@10202 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10202>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_2>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p1>; + }; + + cpu_p13: cpu@10203 { + compatible =3D "apple,avalanche"; + device_type =3D "cpu"; + reg =3D <0x0 0x10203>; + enable-method =3D "spin-table"; + cpu-release-addr =3D <0 0>; /* To be filled by loader */ + next-level-cache =3D <&l2_cache_2>; + i-cache-size =3D <0x30000>; + d-cache-size =3D <0x20000>; + operating-points-v2 =3D <&avalanche_opp>; + capacity-dmips-mhz =3D <1024>; + performance-domains =3D <&cpufreq_p1>; + }; + + l2_cache_0: l2-cache-0 { + compatible =3D "cache"; + cache-level =3D <2>; + cache-unified; + cache-size =3D <0x400000>; + }; + + l2_cache_1: l2-cache-1 { + compatible =3D "cache"; + cache-level =3D <2>; + cache-unified; + cache-size =3D <0x1000000>; + }; + + l2_cache_2: l2-cache-2 { + compatible =3D "cache"; + cache-level =3D <2>; + cache-unified; + cache-size =3D <0x1000000>; + }; + }; + + blizzard_opp: opp-table-0 { + compatible =3D "operating-points-v2"; + opp-shared; + + /* pstate #1 is a dummy clone of #2 */ + opp02 { + opp-hz =3D /bits/ 64 <912000000>; + opp-level =3D <2>; + clock-latency-ns =3D <7700>; + }; + opp03 { + opp-hz =3D /bits/ 64 <1284000000>; + opp-level =3D <3>; + clock-latency-ns =3D <25000>; + }; + opp04 { + opp-hz =3D /bits/ 64 <1752000000>; + opp-level =3D <4>; + clock-latency-ns =3D <33000>; + }; + opp05 { + opp-hz =3D /bits/ 64 <2004000000>; + opp-level =3D <5>; + clock-latency-ns =3D <38000>; + }; + opp06 { + opp-hz =3D /bits/ 64 <2256000000>; + opp-level =3D <6>; + clock-latency-ns =3D <44000>; + }; + opp07 { + opp-hz =3D /bits/ 64 <2424000000>; + opp-level =3D <7>; + clock-latency-ns =3D <48000>; + }; + }; + + avalanche_opp: opp-table-1 { + compatible =3D "operating-points-v2"; + opp-shared; + + opp01 { + opp-hz =3D /bits/ 64 <702000000>; + opp-level =3D <1>; + clock-latency-ns =3D <7400>; + }; + opp02 { + opp-hz =3D /bits/ 64 <948000000>; + opp-level =3D <2>; + clock-latency-ns =3D <18000>; + }; + opp03 { + opp-hz =3D /bits/ 64 <1188000000>; + opp-level =3D <3>; + clock-latency-ns =3D <21000>; + }; + opp04 { + opp-hz =3D /bits/ 64 <1452000000>; + opp-level =3D <4>; + clock-latency-ns =3D <24000>; + }; + opp05 { + opp-hz =3D /bits/ 64 <1704000000>; + opp-level =3D <5>; + clock-latency-ns =3D <28000>; + }; + opp06 { + opp-hz =3D /bits/ 64 <1968000000>; + opp-level =3D <6>; + clock-latency-ns =3D <31000>; + }; + opp07 { + opp-hz =3D /bits/ 64 <2208000000>; + opp-level =3D <7>; + clock-latency-ns =3D <33000>; + }; + opp08 { + opp-hz =3D /bits/ 64 <2400000000>; + opp-level =3D <8>; + clock-latency-ns =3D <45000>; + }; + opp09 { + opp-hz =3D /bits/ 64 <2568000000>; + opp-level =3D <9>; + clock-latency-ns =3D <47000>; + }; + opp10 { + opp-hz =3D /bits/ 64 <2724000000>; + opp-level =3D <10>; + clock-latency-ns =3D <50000>; + }; + opp11 { + opp-hz =3D /bits/ 64 <2868000000>; + opp-level =3D <11>; + clock-latency-ns =3D <52000>; + }; + opp12 { + opp-hz =3D /bits/ 64 <3000000000>; + opp-level =3D <12>; + clock-latency-ns =3D <57000>; + }; + opp13 { + opp-hz =3D /bits/ 64 <3132000000>; + opp-level =3D <13>; + clock-latency-ns =3D <60000>; + }; + opp14 { + opp-hz =3D /bits/ 64 <3264000000>; + opp-level =3D <14>; + clock-latency-ns =3D <64000>; + }; + opp15 { + opp-hz =3D /bits/ 64 <3360000000>; + opp-level =3D <15>; + clock-latency-ns =3D <64000>; + turbo-mode; + }; + opp16 { + opp-hz =3D /bits/ 64 <3408000000>; + opp-level =3D <16>; + clock-latency-ns =3D <64000>; + turbo-mode; + }; + opp17 { + opp-hz =3D /bits/ 64 <3504000000>; + opp-level =3D <17>; + clock-latency-ns =3D <64000>; + turbo-mode; + }; + }; + + pmu-e { + compatible =3D "apple,blizzard-pmu"; + interrupt-parent =3D <&aic>; + interrupts =3D ; + }; + + pmu-p { + compatible =3D "apple,avalanche-pmu"; + interrupt-parent =3D <&aic>; + interrupts =3D ; + }; + + timer { + compatible =3D "arm,armv8-timer"; + interrupt-parent =3D <&aic>; + interrupt-names =3D "phys", "virt", "hyp-phys", "hyp-virt"; + interrupts =3D , + , + , + ; + }; + + clkref: clock-ref { + compatible =3D "fixed-clock"; + #clock-cells =3D <0>; + clock-frequency =3D <24000000>; + clock-output-names =3D "clkref"; + }; + + clk_200m: clock-200m { + compatible =3D "fixed-clock"; + #clock-cells =3D <0>; + clock-frequency =3D <200000000>; + clock-output-names =3D "clk_200m"; + }; + + /* + * This is a fabulated representation of the input clock + * to NCO since we don't know the true clock tree. + */ + nco_clkref: clock-ref-nco { + compatible =3D "fixed-clock"; + #clock-cells =3D <0>; + clock-output-names =3D "nco_ref"; + }; + + reserved-memory { + #address-cells =3D <2>; + #size-cells =3D <2>; + ranges; + + gpu_globals: globals { + status =3D "disabled"; + }; + + gpu_hw_cal_a: hw-cal-a { + status =3D "disabled"; + }; + + gpu_hw_cal_b: hw-cal-b { + status =3D "disabled"; + }; + + uat_handoff: uat-handoff { + status =3D "disabled"; + }; + + uat_pagetables: uat-pagetables { + status =3D "disabled"; + }; + + uat_ttbs: uat-ttbs { + status =3D "disabled"; + }; + }; +}; diff --git a/arch/arm64/boot/dts/apple/t602x-die0.dtsi b/arch/arm64/boot/dt= s/apple/t602x-die0.dtsi new file mode 100644 index 0000000000000000000000000000000000000000..2e7d2bf08ddc829e87d37761635= 03b0eaae843a7 --- /dev/null +++ b/arch/arm64/boot/dts/apple/t602x-die0.dtsi @@ -0,0 +1,575 @@ +// SPDX-License-Identifier: GPL-2.0+ OR MIT +/* + * Devices used on die 0 on the Apple T6022 "M2 Ultra" SoC and present on + * Apple T6020 / T6021 "M2 Pro" / "M2 Max". + * + * Copyright The Asahi Linux Contributors + */ + + nco: clock-controller@28e03c000 { + compatible =3D "apple,t6020-nco", "apple,t8103-nco"; + reg =3D <0x2 0x8e03c000 0x0 0x14000>; + clocks =3D <&nco_clkref>; + #clock-cells =3D <1>; + }; + + aic: interrupt-controller@28e100000 { + compatible =3D "apple,t6020-aic", "apple,aic2"; + #interrupt-cells =3D <4>; + interrupt-controller; + reg =3D <0x2 0x8e100000 0x0 0xc000>, + <0x2 0x8e10c000 0x0 0x1000>; + reg-names =3D "core", "event"; + power-domains =3D <&ps_aic>; + }; + + nub_spmi0: spmi@29e114000 { + compatible =3D "apple,t6020-spmi", "apple,t8103-spmi"; + reg =3D <0x2 0x9e114000 0x0 0x100>; + #address-cells =3D <2>; + #size-cells =3D <0>; + + pmic1: pmic@f { + compatible =3D "apple,maverick-pmic", "apple,spmi-nvmem"; + reg =3D <0xb SPMI_USID>; + + nvmem-layout { + compatible =3D "fixed-layout"; + #address-cells =3D <1>; + #size-cells =3D <1>; + + pm_setting: pm-setting@1405 { + reg =3D <0x1405 0x1>; + }; + + rtc_offset: rtc-offset@1411 { + reg =3D <0x1411 0x6>; + }; + + boot_stage: boot-stage@6001 { + reg =3D <0x6001 0x1>; + }; + + boot_error_count: boot-error-count@6002,0 { + reg =3D <0x6002 0x1>; + bits =3D <0 4>; + }; + + panic_count: panic-count@6002,4 { + reg =3D <0x6002 0x1>; + bits =3D <4 4>; + }; + + boot_error_stage: boot-error-stage@6003 { + reg =3D <0x6003 0x1>; + }; + + shutdown_flag: shutdown-flag@600f,3 { + reg =3D <0x600f 0x1>; + bits =3D <3 1>; + }; + + fault_shadow: fault-shadow@867b { + reg =3D <0x867b 0x10>; + }; + + socd: socd@8b00 { + reg =3D <0x8b00 0x400>; + }; + }; + }; + }; + + wdt: watchdog@29e2c4000 { + compatible =3D "apple,t6020-wdt", "apple,t8103-wdt"; + reg =3D <0x2 0x9e2c4000 0x0 0x4000>; + clocks =3D <&clkref>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + }; + + smc_mbox: mbox@2a2408000 { + compatible =3D "apple,t6020-asc-mailbox", "apple,asc-mailbox-v4"; + reg =3D <0x2 0xa2408000 0x0 0x4000>; + interrupt-parent =3D <&aic>; + interrupts =3D , + , + , + ; + interrupt-names =3D "send-empty", "send-not-empty", + "recv-empty", "recv-not-empty"; + #mbox-cells =3D <0>; + }; + + smc: smc@2a2400000 { + compatible =3D "apple,t6020-smc", "apple,t8103-smc"; + reg =3D <0x2 0xa2400000 0x0 0x4000>, + <0x2 0xa3e00000 0x0 0x100000>; + reg-names =3D "smc", "sram"; + mboxes =3D <&smc_mbox>; + + smc_gpio: gpio { + compatible =3D "apple,smc-gpio"; + gpio-controller; + #gpio-cells =3D <2>; + }; + + smc_reboot: reboot { + compatible =3D "apple,smc-reboot"; + nvmem-cells =3D <&shutdown_flag>, <&boot_stage>, + <&boot_error_count>, <&panic_count>; + nvmem-cell-names =3D "shutdown_flag", "boot_stage", + "boot_error_count", "panic_count"; + }; + }; + + pinctrl_smc: pinctrl@2a2820000 { + compatible =3D "apple,t6020-pinctrl", "apple,t8103-pinctrl"; + reg =3D <0x2 0xa2820000 0x0 0x4000>; + + gpio-controller; + #gpio-cells =3D <2>; + gpio-ranges =3D <&pinctrl_smc 0 0 30>; + apple,npins =3D <30>; + + interrupt-controller; + #interrupt-cells =3D <2>; + interrupt-parent =3D <&aic>; + interrupts =3D , + , + , + , + , + , + ; + }; + + sio_dart: iommu@39b008000 { + compatible =3D "apple,t6020-dart", "apple,t8110-dart"; + reg =3D <0x3 0x9b008000 0x0 0x8000>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + #iommu-cells =3D <1>; + power-domains =3D <&ps_sio_cpu>; + }; + + fpwm0: pwm@39b030000 { + compatible =3D "apple,t6020-fpwm", "apple,s5l-fpwm"; + reg =3D <0x3 0x9b030000 0x0 0x4000>; + power-domains =3D <&ps_fpwm0>; + clocks =3D <&clkref>; + #pwm-cells =3D <2>; + status =3D "disabled"; + }; + + i2c0: i2c@39b040000 { + compatible =3D "apple,t6020-i2c", "apple,t8103-i2c"; + reg =3D <0x3 0x9b040000 0x0 0x4000>; + clocks =3D <&clkref>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + pinctrl-0 =3D <&i2c0_pins>; + pinctrl-names =3D "default"; + power-domains =3D <&ps_i2c0>; + #address-cells =3D <0x1>; + #size-cells =3D <0x0>; + }; + + i2c1: i2c@39b044000 { + compatible =3D "apple,t6020-i2c", "apple,t8103-i2c"; + reg =3D <0x3 0x9b044000 0x0 0x4000>; + clocks =3D <&clkref>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + pinctrl-0 =3D <&i2c1_pins>; + pinctrl-names =3D "default"; + power-domains =3D <&ps_i2c1>; + #address-cells =3D <0x1>; + #size-cells =3D <0x0>; + status =3D "disabled"; + }; + + i2c2: i2c@39b048000 { + compatible =3D "apple,t6020-i2c", "apple,t8103-i2c"; + reg =3D <0x3 0x9b048000 0x0 0x4000>; + clocks =3D <&clkref>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + pinctrl-0 =3D <&i2c2_pins>; + pinctrl-names =3D "default"; + power-domains =3D <&ps_i2c2>; + #address-cells =3D <0x1>; + #size-cells =3D <0x0>; + status =3D "disabled"; + }; + + i2c3: i2c@39b04c000 { + compatible =3D "apple,t6020-i2c", "apple,t8103-i2c"; + reg =3D <0x3 0x9b04c000 0x0 0x4000>; + clocks =3D <&clkref>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + pinctrl-0 =3D <&i2c3_pins>; + pinctrl-names =3D "default"; + power-domains =3D <&ps_i2c3>; + #address-cells =3D <0x1>; + #size-cells =3D <0x0>; + status =3D "disabled"; + }; + + i2c4: i2c@39b050000 { + compatible =3D "apple,t6020-i2c", "apple,t8103-i2c"; + reg =3D <0x3 0x9b050000 0x0 0x4000>; + clocks =3D <&clkref>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + pinctrl-0 =3D <&i2c4_pins>; + pinctrl-names =3D "default"; + power-domains =3D <&ps_i2c4>; + #address-cells =3D <0x1>; + #size-cells =3D <0x0>; + status =3D "disabled"; + }; + + i2c5: i2c@39b054000 { + compatible =3D "apple,t6020-i2c", "apple,t8103-i2c"; + reg =3D <0x3 0x9b054000 0x0 0x4000>; + clocks =3D <&clkref>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + pinctrl-0 =3D <&i2c5_pins>; + pinctrl-names =3D "default"; + power-domains =3D <&ps_i2c5>; + #address-cells =3D <0x1>; + #size-cells =3D <0x0>; + status =3D "disabled"; + }; + + i2c6: i2c@39b054000 { + compatible =3D "apple,t6020-i2c", "apple,t8103-i2c"; + reg =3D <0x3 0x9b054000 0x0 0x4000>; + clocks =3D <&clkref>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + pinctrl-0 =3D <&i2c6_pins>; + pinctrl-names =3D "default"; + power-domains =3D <&ps_i2c6>; + #address-cells =3D <0x1>; + #size-cells =3D <0x0>; + status =3D "disabled"; + }; + + i2c7: i2c@39b054000 { + compatible =3D "apple,t6020-i2c", "apple,t8103-i2c"; + reg =3D <0x3 0x9b054000 0x0 0x4000>; + clocks =3D <&clkref>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + pinctrl-0 =3D <&i2c7_pins>; + pinctrl-names =3D "default"; + power-domains =3D <&ps_i2c7>; + #address-cells =3D <0x1>; + #size-cells =3D <0x0>; + status =3D "disabled"; + }; + + i2c8: i2c@39b054000 { + compatible =3D "apple,t6020-i2c", "apple,t8103-i2c"; + reg =3D <0x3 0x9b054000 0x0 0x4000>; + clocks =3D <&clkref>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + pinctrl-0 =3D <&i2c8_pins>; + pinctrl-names =3D "default"; + power-domains =3D <&ps_i2c8>; + #address-cells =3D <0x1>; + #size-cells =3D <0x0>; + status =3D "disabled"; + }; + + spi1: spi@39b104000 { + compatible =3D "apple,t6020-spi", "apple,t8103-spi"; + reg =3D <0x3 0x9b104000 0x0 0x4000>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + #address-cells =3D <1>; + #size-cells =3D <0>; + clocks =3D <&clk_200m>; + pinctrl-0 =3D <&spi1_pins>; + pinctrl-names =3D "default"; + power-domains =3D <&ps_spi1>; + status =3D "disabled"; + }; + + spi2: spi@39b108000 { + compatible =3D "apple,t6020-spi", "apple,t8103-spi"; + reg =3D <0x3 0x9b108000 0x0 0x4000>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + #address-cells =3D <1>; + #size-cells =3D <0>; + clocks =3D <&clkref>; + pinctrl-0 =3D <&spi2_pins>; + pinctrl-names =3D "default"; + power-domains =3D <&ps_spi2>; + status =3D "disabled"; + }; + + spi4: spi@39b110000 { + compatible =3D "apple,t6020-spi", "apple,t8103-spi"; + reg =3D <0x3 0x9b110000 0x0 0x4000>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + #address-cells =3D <1>; + #size-cells =3D <0>; + clocks =3D <&clkref>; + pinctrl-0 =3D <&spi4_pins>; + pinctrl-names =3D "default"; + power-domains =3D <&ps_spi4>; + status =3D "disabled"; + }; + + serial0: serial@39b200000 { + compatible =3D "apple,s5l-uart"; + reg =3D <0x3 0x9b200000 0x0 0x4000>; + reg-io-width =3D <4>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + /* + * TODO: figure out the clocking properly, there may + * be a third selectable clock. + */ + clocks =3D <&clkref>, <&clkref>; + clock-names =3D "uart", "clk_uart_baud0"; + power-domains =3D <&ps_uart0>; + status =3D "disabled"; + }; + + admac: dma-controller@39b400000 { + compatible =3D "apple,t6020-admac", "apple,t8103-admac"; + reg =3D <0x3 0x9b400000 0x0 0x34000>; + #dma-cells =3D <1>; + dma-channels =3D <16>; + interrupts-extended =3D <0>, + <&aic AIC_IRQ 0 1218 IRQ_TYPE_LEVEL_HIGH>, + <0>, + <0>; + iommus =3D <&sio_dart 2>; + power-domains =3D <&ps_sio_adma>; + resets =3D <&ps_audio_p>; + }; + + mca: mca@39b600000 { + compatible =3D "apple,t6020-mca", "apple,t8103-mca"; + reg =3D <0x3 0x9b600000 0x0 0x10000>, + <0x3 0x9b500000 0x0 0x20000>; + clocks =3D <&nco 0>, <&nco 1>, <&nco 2>, <&nco 3>; + dmas =3D <&admac 0>, <&admac 1>, <&admac 2>, <&admac 3>, + <&admac 4>, <&admac 5>, <&admac 6>, <&admac 7>, + <&admac 8>, <&admac 9>, <&admac 10>, <&admac 11>, + <&admac 12>, <&admac 13>, <&admac 14>, <&admac 15>; + dma-names =3D "tx0a", "rx0a", "tx0b", "rx0b", + "tx1a", "rx1a", "tx1b", "rx1b", + "tx2a", "rx2a", "tx2b", "rx2b", + "tx3a", "rx3a", "tx3b", "rx3b"; + interrupt-parent =3D <&aic>; + interrupts =3D , + , + , + ; + power-domains =3D <&ps_audio_p>, <&ps_mca0>, <&ps_mca1>, + <&ps_mca2>, <&ps_mca3>; + resets =3D <&ps_audio_p>; + #sound-dai-cells =3D <1>; + }; + + gpu: gpu@406400000 { + compatible =3D "apple,agx-g14s"; + reg =3D <0x4 0x6400000 0 0x40000>, + <0x4 0x4000000 0 0x1000000>; + reg-names =3D "asc", "sgx"; + mboxes =3D <&agx_mbox>; + power-domains =3D <&ps_gfx>; + memory-region =3D <&uat_ttbs>, <&uat_pagetables>, <&uat_handoff>, + <&gpu_hw_cal_a>, <&gpu_hw_cal_b>, <&gpu_globals>; + memory-region-names =3D "ttbs", "pagetables", "handoff", + "hw-cal-a", "hw-cal-b", "globals"; + + apple,firmware-abi =3D <0 0 0>; + }; + + agx_mbox: mbox@406408000 { + compatible =3D "apple,t6020-asc-mailbox", "apple,asc-mailbox-v4"; + reg =3D <0x4 0x6408000 0x0 0x4000>; + interrupt-parent =3D <&aic>; + interrupts =3D , + , + , + ; + interrupt-names =3D "send-empty", "send-not-empty", + "recv-empty", "recv-not-empty"; + #mbox-cells =3D <0>; + }; + + pcie0: pcie@580000000 { + compatible =3D "apple,t6020-pcie"; + device_type =3D "pci"; + + reg =3D <0x5 0x80000000 0x0 0x1000000>, /* config */ + <0x5 0x91000000 0x0 0x4000>, /* rc */ + <0x5 0x94008000 0x0 0x4000>, /* port0 */ + <0x5 0x95008000 0x0 0x4000>, /* port1 */ + <0x5 0x96008000 0x0 0x4000>, /* port2 */ + <0x5 0x97008000 0x0 0x4000>, /* port3 */ + <0x5 0x9e00c000 0x0 0x4000>, /* phy0 */ + <0x5 0x9e010000 0x0 0x4000>, /* phy1 */ + <0x5 0x9e014000 0x0 0x4000>, /* phy2 */ + <0x5 0x9e018000 0x0 0x4000>; /* phy3 */ + reg-names =3D "config", "rc", + "port0", "port1", "port2", "port3", + "phy0", "phy1", "phy2", "phy3"; + + interrupt-parent =3D <&aic>; + interrupts =3D , + , + , + ; + + msi-controller; + msi-parent =3D <&pcie0>; + msi-ranges =3D <&aic AIC_IRQ 0 1672 IRQ_TYPE_EDGE_RISING 32>; + + iommu-map =3D <0x100 &pcie0_dart_0 1 1>, + <0x200 &pcie0_dart_1 1 1>, + <0x300 &pcie0_dart_2 1 1>, + <0x400 &pcie0_dart_3 1 1>; + iommu-map-mask =3D <0xff00>; + + bus-range =3D <0 4>; + #address-cells =3D <3>; + #size-cells =3D <2>; + ranges =3D <0x43000000 0x5 0xa0000000 0x5 0xa0000000 0x0 0x20000000>, + <0x02000000 0x0 0xc0000000 0x5 0xc0000000 0x0 0x40000000>; + + power-domains =3D <&ps_apcie_gp_sys>; + pinctrl-0 =3D <&pcie_pins>; + pinctrl-names =3D "default"; + + port00: pci@0,0 { + device_type =3D "pci"; + reg =3D <0x0 0x0 0x0 0x0 0x0>; + reset-gpios =3D <&pinctrl_ap 4 GPIO_ACTIVE_LOW>; + + #address-cells =3D <3>; + #size-cells =3D <2>; + ranges; + + interrupt-controller; + #interrupt-cells =3D <1>; + + interrupt-map-mask =3D <0 0 0 7>; + interrupt-map =3D <0 0 0 1 &port00 0 0 0 0>, + <0 0 0 2 &port00 0 0 0 1>, + <0 0 0 3 &port00 0 0 0 2>, + <0 0 0 4 &port00 0 0 0 3>; + }; + + port01: pci@1,0 { + device_type =3D "pci"; + reg =3D <0x800 0x0 0x0 0x0 0x0>; + reset-gpios =3D <&pinctrl_ap 5 GPIO_ACTIVE_LOW>; + + #address-cells =3D <3>; + #size-cells =3D <2>; + ranges; + + interrupt-controller; + #interrupt-cells =3D <1>; + + interrupt-map-mask =3D <0 0 0 7>; + interrupt-map =3D <0 0 0 1 &port01 0 0 0 0>, + <0 0 0 2 &port01 0 0 0 1>, + <0 0 0 3 &port01 0 0 0 2>, + <0 0 0 4 &port01 0 0 0 3>; + status =3D "disabled"; + }; + + port02: pci@2,0 { + device_type =3D "pci"; + reg =3D <0x1000 0x0 0x0 0x0 0x0>; + reset-gpios =3D <&pinctrl_ap 6 GPIO_ACTIVE_LOW>; + + #address-cells =3D <3>; + #size-cells =3D <2>; + ranges; + + interrupt-controller; + #interrupt-cells =3D <1>; + + interrupt-map-mask =3D <0 0 0 7>; + interrupt-map =3D <0 0 0 1 &port02 0 0 0 0>, + <0 0 0 2 &port02 0 0 0 1>, + <0 0 0 3 &port02 0 0 0 2>, + <0 0 0 4 &port02 0 0 0 3>; + status =3D "disabled"; + }; + + port03: pci@3,0 { + device_type =3D "pci"; + reg =3D <0x1800 0x0 0x0 0x0 0x0>; + reset-gpios =3D <&pinctrl_ap 7 GPIO_ACTIVE_LOW>; + + #address-cells =3D <3>; + #size-cells =3D <2>; + ranges; + + interrupt-controller; + #interrupt-cells =3D <1>; + + interrupt-map-mask =3D <0 0 0 7>; + interrupt-map =3D <0 0 0 1 &port03 0 0 0 0>, + <0 0 0 2 &port03 0 0 0 1>, + <0 0 0 3 &port03 0 0 0 2>, + <0 0 0 4 &port03 0 0 0 3>; + status =3D "disabled"; + }; + }; + + pcie0_dart_0: iommu@594000000 { + compatible =3D "apple,t6020-dart", "apple,t8110-dart"; + reg =3D <0x5 0x94000000 0x0 0x4000>; + #iommu-cells =3D <1>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + power-domains =3D <&ps_apcie_gp_sys>; + }; + + pcie0_dart_1: iommu@595000000 { + compatible =3D "apple,t6020-dart", "apple,t8110-dart"; + reg =3D <0x5 0x95000000 0x0 0x4000>; + #iommu-cells =3D <1>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + power-domains =3D <&ps_apcie_gp_sys>; + status =3D "disabled"; + }; + + pcie0_dart_2: iommu@596000000 { + compatible =3D "apple,t6020-dart", "apple,t8110-dart"; + reg =3D <0x5 0x96000000 0x0 0x4000>; + #iommu-cells =3D <1>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + power-domains =3D <&ps_apcie_gp_sys>; + status =3D "disabled"; + }; + + pcie0_dart_3: iommu@597000000 { + compatible =3D "apple,t6020-dart", "apple,t8110-dart"; + reg =3D <0x5 0x97000000 0x0 0x4000>; + #iommu-cells =3D <1>; + interrupt-parent =3D <&aic>; + interrupts =3D ; + power-domains =3D <&ps_apcie_gp_sys>; + status =3D "disabled"; + }; diff --git a/arch/arm64/boot/dts/apple/t602x-dieX.dtsi b/arch/arm64/boot/dt= s/apple/t602x-dieX.dtsi new file mode 100644 index 0000000000000000000000000000000000000000..cb07fd82b32e67a41d8290bf834= 7d4eca474af23 --- /dev/null +++ b/arch/arm64/boot/dts/apple/t602x-dieX.dtsi @@ -0,0 +1,128 @@ +// SPDX-License-Identifier: GPL-2.0+ OR MIT +/* + * Nodes present on both dies of T6022 (M2 Ultra) and present on M2 Pro/Ma= x. + * + * Copyright The Asahi Linux Contributors + */ + + DIE_NODE(cpufreq_e): cpufreq@210e20000 { + compatible =3D "apple,t6020-cluster-cpufreq", "apple,t8112-cluster-cpufr= eq"; + reg =3D <0x2 0x10e20000 0 0x1000>; + #performance-domain-cells =3D <0>; + }; + + DIE_NODE(cpufreq_p0): cpufreq@211e20000 { + compatible =3D "apple,t6020-cluster-cpufreq", "apple,t8112-cluster-cpufr= eq"; + reg =3D <0x2 0x11e20000 0 0x1000>; + #performance-domain-cells =3D <0>; + }; + + DIE_NODE(cpufreq_p1): cpufreq@212e20000 { + compatible =3D "apple,t6020-cluster-cpufreq", "apple,t8112-cluster-cpufr= eq"; + reg =3D <0x2 0x12e20000 0 0x1000>; + #performance-domain-cells =3D <0>; + }; + + DIE_NODE(pmgr): power-management@28e080000 { + compatible =3D "apple,t6020-pmgr", "apple,t8103-pmgr", "syscon", "simple= -mfd"; + #address-cells =3D <1>; + #size-cells =3D <1>; + reg =3D <0x2 0x8e080000 0 0x8000>; + }; + + DIE_NODE(pmgr_south): power-management@28e680000 { + compatible =3D "apple,t6020-pmgr", "apple,t8103-pmgr", "syscon", "simple= -mfd"; + #address-cells =3D <1>; + #size-cells =3D <1>; + reg =3D <0x2 0x8e680000 0 0x8000>; + }; + + DIE_NODE(pmgr_east): power-management@290280000 { + compatible =3D "apple,t6020-pmgr", "apple,t8103-pmgr", "syscon", "simple= -mfd"; + #address-cells =3D <1>; + #size-cells =3D <1>; + reg =3D <0x2 0x90280000 0 0xc000>; + }; + + DIE_NODE(pinctrl_nub): pinctrl@29e1f0000 { + compatible =3D "apple,t6020-pinctrl", "apple,t8103-pinctrl"; + reg =3D <0x2 0x9e1f0000 0x0 0x4000>; + power-domains =3D <&DIE_NODE(ps_nub_gpio)>; + + gpio-controller; + #gpio-cells =3D <2>; + gpio-ranges =3D <&DIE_NODE(pinctrl_nub) 0 0 30>; + apple,npins =3D <30>; + + interrupt-controller; + #interrupt-cells =3D <2>; + interrupt-parent =3D <&aic>; + interrupts =3D , + , + , + , + , + , + ; + }; + + DIE_NODE(pmgr_mini): power-management@29e280000 { + compatible =3D "apple,t6020-pmgr", "apple,t8103-pmgr", "syscon", "simple= -mfd"; + #address-cells =3D <1>; + #size-cells =3D <1>; + reg =3D <0x2 0x9e280000 0 0x4000>; + }; + + DIE_NODE(pinctrl_aop): pinctrl@2a6820000 { + compatible =3D "apple,t6020-pinctrl", "apple,t8103-pinctrl"; + reg =3D <0x2 0xa6820000 0x0 0x4000>; + + gpio-controller; + #gpio-cells =3D <2>; + gpio-ranges =3D <&DIE_NODE(pinctrl_aop) 0 0 72>; + apple,npins =3D <72>; + + interrupt-controller; + #interrupt-cells =3D <2>; + interrupt-parent =3D <&aic>; + interrupts =3D , + , + , + , + , + , + ; + }; + + DIE_NODE(pinctrl_ap): pinctrl@39b028000 { + compatible =3D "apple,t6020-pinctrl", "apple,t8103-pinctrl"; + reg =3D <0x3 0x9b028000 0x0 0x4000>; + + interrupt-parent =3D <&aic>; + interrupts =3D , + , + , + , + , + , + ; + + clocks =3D <&clkref>; + power-domains =3D <&DIE_NODE(ps_gpio)>; + + gpio-controller; + #gpio-cells =3D <2>; + gpio-ranges =3D <&DIE_NODE(pinctrl_ap) 0 0 255>; + apple,npins =3D <255>; + + interrupt-controller; + #interrupt-cells =3D <2>; + }; + + DIE_NODE(pmgr_gfx): power-management@404e80000 { + compatible =3D "apple,t6020-pmgr", "apple,t8103-pmgr", "syscon", "simple= -mfd"; + #address-cells =3D <1>; + #size-cells =3D <1>; + + reg =3D <0x4 0x4e80000 0 0x4000>; + }; diff --git a/arch/arm64/boot/dts/apple/t602x-gpio-pins.dtsi b/arch/arm64/bo= ot/dts/apple/t602x-gpio-pins.dtsi new file mode 100644 index 0000000000000000000000000000000000000000..e41b6475f7921840cd90b0203c6= 822808f13c5e3 --- /dev/null +++ b/arch/arm64/boot/dts/apple/t602x-gpio-pins.dtsi @@ -0,0 +1,81 @@ +// SPDX-License-Identifier: GPL-2.0+ OR MIT +/* + * GPIO pin mappings for Apple T602x SoCs. + * + * Copyright The Asahi Linux Contributors + */ + +&pinctrl_ap { + i2c0_pins: i2c0-pins { + pinmux =3D , + ; + }; + + i2c1_pins: i2c1-pins { + pinmux =3D , + ; + }; + + i2c2_pins: i2c2-pins { + pinmux =3D , + ; + }; + + i2c3_pins: i2c3-pins { + pinmux =3D , + ; + }; + + i2c4_pins: i2c4-pins { + pinmux =3D , + ; + }; + + i2c5_pins: i2c5-pins { + pinmux =3D , + ; + }; + + i2c6_pins: i2c6-pins { + pinmux =3D , + ; + }; + + i2c7_pins: i2c7-pins { + pinmux =3D , + ; + }; + + i2c8_pins: i2c8-pins { + pinmux =3D , + ; + }; + + spi1_pins: spi1-pins { + pinmux =3D , /* SDI */ + , /* SDO */ + , /* SCK */ + ; /* CS */ + }; + + spi2_pins: spi2-pins { + pinmux =3D , /* SDI */ + , /* SDO */ + , /* SCK */ + ; /* CS */ + }; + + spi4_pins: spi4-pins { + pinmux =3D , /* SDI */ + , /* SDO */ + , /* SCK */ + ; /* CS */ + }; + + pcie_pins: pcie-pins { + pinmux =3D , + , + , + ; + }; +}; diff --git a/arch/arm64/boot/dts/apple/t602x-nvme.dtsi b/arch/arm64/boot/dt= s/apple/t602x-nvme.dtsi new file mode 100644 index 0000000000000000000000000000000000000000..590cec8ac804c0b5b35a53ad206= 66aee9bdb4da7 --- /dev/null +++ b/arch/arm64/boot/dts/apple/t602x-nvme.dtsi @@ -0,0 +1,42 @@ +// SPDX-License-Identifier: GPL-2.0+ OR MIT +/* + * NVMe related devices for Apple T602x SoCs. + * + * Copyright The Asahi Linux Contributors + */ + + DIE_NODE(ans_mbox): mbox@347408000 { + compatible =3D "apple,t6020-asc-mailbox", "apple,asc-mailbox-v4"; + reg =3D <0x3 0x47408000 0x0 0x4000>; + interrupt-parent =3D <&aic>; + interrupts =3D , + , + , + ; + interrupt-names =3D "send-empty", "send-not-empty", + "recv-empty", "recv-not-empty"; + power-domains =3D <&DIE_NODE(ps_ans2)>; + #mbox-cells =3D <0>; + }; + + DIE_NODE(sart): sart@34bc50000 { + compatible =3D "apple,t6020-sart", "apple,t6000-sart"; + reg =3D <0x3 0x4bc50000 0x0 0x10000>; + power-domains =3D <&DIE_NODE(ps_ans2)>; + }; + + DIE_NODE(nvme): nvme@34bcc0000 { + compatible =3D "apple,t6020-nvme-ans2", "apple,t8103-nvme-ans2"; + reg =3D <0x3 0x4bcc0000 0x0 0x40000>, <0x3 0x47400000 0x0 0x4000>; + reg-names =3D "nvme", "ans"; + interrupt-parent =3D <&aic>; + /* The NVME interrupt is always routed to die 0 */ + interrupts =3D ; + mboxes =3D <&DIE_NODE(ans_mbox)>; + apple,sart =3D <&DIE_NODE(sart)>; + power-domains =3D <&DIE_NODE(ps_ans2)>, + <&DIE_NODE(ps_apcie_st_sys)>, + <&DIE_NODE(ps_apcie_st1_sys)>; + power-domain-names =3D "ans", "apcie0", "apcie1"; + resets =3D <&DIE_NODE(ps_ans2)>; + }; diff --git a/arch/arm64/boot/dts/apple/t602x-pmgr.dtsi b/arch/arm64/boot/dt= s/apple/t602x-pmgr.dtsi new file mode 100644 index 0000000000000000000000000000000000000000..f5382a2faf0b2530439ddf29e19= 12dd61b158028 --- /dev/null +++ b/arch/arm64/boot/dts/apple/t602x-pmgr.dtsi @@ -0,0 +1,2265 @@ +// SPDX-License-Identifier: GPL-2.0+ OR MIT +/* + * PMGR Power domains for Apple T602x "M2 Pro/Max/Ultra" SoC + * + * Copyright The Asahi Linux Contributors + */ + +&DIE_NODE(pmgr) { + DIE_NODE(ps_afi): power-controller@100 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x100 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afi); + apple,always-on; /* Apple Fabric, CPU interface is here */ + }; + + DIE_NODE(ps_aic): power-controller@108 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x108 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(aic); + apple,always-on; /* Core device */ + }; + + DIE_NODE(ps_dwi): power-controller@110 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x110 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dwi); + }; + + DIE_NODE(ps_pms): power-controller@118 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x118 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(pms); + apple,always-on; /* Core device */ + }; + + DIE_NODE(ps_gpio): power-controller@120 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x120 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(gpio); + power-domains =3D <&DIE_NODE(ps_sio)>, <&DIE_NODE(ps_pms)>; + }; + + DIE_NODE(ps_soc_dpe): power-controller@128 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x128 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(soc_dpe); + apple,always-on; /* Core device */ + }; + + DIE_NODE(ps_pms_c1ppt): power-controller@130 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x130 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(pms_c1ppt); + apple,always-on; /* Core device */ + }; + + DIE_NODE(ps_pmgr_soc_ocla): power-controller@138 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x138 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(pmgr_soc_ocla); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_amcc0): power-controller@168 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x168 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(amcc0); + apple,always-on; /* Memory controller */ + }; + + DIE_NODE(ps_amcc2): power-controller@170 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x170 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(amcc2); + apple,always-on; /* Memory controller */ + }; + + DIE_NODE(ps_dcs_00): power-controller@178 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x178 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_00); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_01): power-controller@180 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x180 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_01); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_02): power-controller@188 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x188 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_02); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_03): power-controller@190 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x190 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_03); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_08): power-controller@198 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x198 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_08); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_09): power-controller@1a0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1a0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_09); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_10): power-controller@1a8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1a8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_10); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_11): power-controller@1b0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1b0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_11); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_afnc1_ioa): power-controller@1b8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1b8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc1_ioa); + apple,always-on; /* Apple Fabric */ + power-domains =3D <&DIE_NODE(ps_afi)>; + }; + + DIE_NODE(ps_afc): power-controller@1d0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1d0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afc); + apple,always-on; /* Apple Fabric, CPU interface is here */ + }; + + DIE_NODE(ps_afnc0_ioa): power-controller@1e8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1e8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc0_ioa); + apple,always-on; /* Apple Fabric */ + power-domains =3D <&DIE_NODE(ps_afi)>; + }; + + DIE_NODE(ps_afnc1_ls): power-controller@1f0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1f0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc1_ls); + apple,always-on; /* Apple Fabric */ + power-domains =3D <&DIE_NODE(ps_afnc1_ioa)>; + }; + + DIE_NODE(ps_afnc0_ls): power-controller@1f8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1f8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc0_ls); + apple,always-on; /* Apple Fabric */ + power-domains =3D <&DIE_NODE(ps_afnc0_ioa)>; + }; + + DIE_NODE(ps_afnc1_lw0): power-controller@200 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x200 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc1_lw0); + apple,always-on; /* Apple Fabric */ + power-domains =3D <&DIE_NODE(ps_afnc1_ls)>; + }; + + DIE_NODE(ps_afnc1_lw1): power-controller@208 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x208 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc1_lw1); + apple,always-on; /* Apple Fabric */ + power-domains =3D <&DIE_NODE(ps_afnc1_ls)>; + }; + + DIE_NODE(ps_afnc1_lw2): power-controller@210 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x210 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc1_lw2); + apple,always-on; /* Apple Fabric */ + power-domains =3D <&DIE_NODE(ps_afnc1_ls)>; + }; + + DIE_NODE(ps_afnc0_lw0): power-controller@218 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x218 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc0_lw0); + apple,always-on; /* Apple Fabric */ + power-domains =3D <&DIE_NODE(ps_afnc0_ls)>; + }; + + DIE_NODE(ps_scodec): power-controller@220 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x220 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(scodec); + power-domains =3D <&DIE_NODE(ps_afnc1_lw0)>; + }; + + DIE_NODE(ps_atc0_common): power-controller@228 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x228 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc0_common); + power-domains =3D <&DIE_NODE(ps_afnc1_lw1)>; + }; + + DIE_NODE(ps_atc1_common): power-controller@230 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x230 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc1_common); + power-domains =3D <&DIE_NODE(ps_afnc1_lw1)>; + }; + + DIE_NODE(ps_atc2_common): power-controller@238 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x238 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc2_common); + power-domains =3D <&DIE_NODE(ps_afnc1_lw1)>; + }; + + DIE_NODE(ps_atc3_common): power-controller@240 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x240 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc3_common); + power-domains =3D <&DIE_NODE(ps_afnc1_lw1)>; + }; + + DIE_NODE(ps_dispext1_sys): power-controller@248 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x248 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dispext1_sys); + power-domains =3D <&DIE_NODE(ps_afnc1_lw2)>; + }; + + DIE_NODE(ps_pms_bridge): power-controller@250 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x250 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(pms_bridge); + apple,always-on; /* Core device */ + power-domains =3D <&DIE_NODE(ps_afnc0_lw0)>; + }; + + DIE_NODE(ps_dispext0_sys): power-controller@258 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x258 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dispext0_sys); + power-domains =3D <&DIE_NODE(ps_afnc0_lw0)>, <&DIE_NODE(ps_afr)>; + }; + + DIE_NODE(ps_ane_sys): power-controller@260 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x260 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(ane_sys); + power-domains =3D <&DIE_NODE(ps_afnc0_lw0)>; + }; + + DIE_NODE(ps_avd_sys): power-controller@268 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x268 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(avd_sys); + power-domains =3D <&DIE_NODE(ps_afnc0_lw0)>; + }; + + DIE_NODE(ps_atc0_cio): power-controller@270 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x270 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc0_cio); + power-domains =3D <&DIE_NODE(ps_atc0_common)>; + }; + + DIE_NODE(ps_atc0_pcie): power-controller@278 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x278 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc0_pcie); + power-domains =3D <&DIE_NODE(ps_atc0_common)>; + }; + + DIE_NODE(ps_atc1_cio): power-controller@280 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x280 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc1_cio); + power-domains =3D <&DIE_NODE(ps_atc1_common)>; + }; + + DIE_NODE(ps_atc1_pcie): power-controller@288 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x288 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc1_pcie); + power-domains =3D <&DIE_NODE(ps_atc1_common)>; + }; + + DIE_NODE(ps_atc2_cio): power-controller@290 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x290 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc2_cio); + power-domains =3D <&DIE_NODE(ps_atc2_common)>; + }; + + DIE_NODE(ps_atc2_pcie): power-controller@298 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x298 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc2_pcie); + power-domains =3D <&DIE_NODE(ps_atc2_common)>; + }; + + DIE_NODE(ps_atc3_cio): power-controller@2a0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2a0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc3_cio); + power-domains =3D <&DIE_NODE(ps_atc3_common)>; + }; + + DIE_NODE(ps_atc3_pcie): power-controller@2a8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2a8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc3_pcie); + power-domains =3D <&DIE_NODE(ps_atc3_common)>; + }; + + DIE_NODE(ps_dispext1_fe): power-controller@2b0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2b0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dispext1_fe); + power-domains =3D <&DIE_NODE(ps_dispext1_sys)>; + }; + + DIE_NODE(ps_dispext1_cpu0): power-controller@2b8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2b8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dispext1_cpu0); + power-domains =3D <&DIE_NODE(ps_dispext1_fe)>; + apple,min-state =3D <4>; + }; + + DIE_NODE(ps_dispext0_fe): power-controller@2c0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2c0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dispext0_fe); + power-domains =3D <&DIE_NODE(ps_dispext0_sys)>; + }; + + DIE_NODE(ps_pmp): power-controller@2c8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2c8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(pmp); + }; + + DIE_NODE(ps_pms_sram): power-controller@2d0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2d0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(pms_sram); + }; + + DIE_NODE(ps_dispext0_cpu0): power-controller@2d8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2d8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dispext0_cpu0); + power-domains =3D <&DIE_NODE(ps_dispext0_fe)>; + apple,min-state =3D <4>; + }; + + DIE_NODE(ps_ane_cpu): power-controller@2e0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2e0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(ane_cpu); + power-domains =3D <&DIE_NODE(ps_ane_sys)>; + }; + + DIE_NODE(ps_atc0_cio_pcie): power-controller@2e8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2e8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc0_cio_pcie); + power-domains =3D <&DIE_NODE(ps_atc0_cio)>; + }; + + DIE_NODE(ps_atc0_cio_usb): power-controller@2f0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2f0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc0_cio_usb); + power-domains =3D <&DIE_NODE(ps_atc0_cio)>; + }; + + DIE_NODE(ps_atc1_cio_pcie): power-controller@2f8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2f8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc1_cio_pcie); + power-domains =3D <&DIE_NODE(ps_atc1_cio)>; + }; + + DIE_NODE(ps_atc1_cio_usb): power-controller@300 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x300 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc1_cio_usb); + power-domains =3D <&DIE_NODE(ps_atc1_cio)>; + }; + + DIE_NODE(ps_atc2_cio_pcie): power-controller@308 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x308 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc2_cio_pcie); + power-domains =3D <&DIE_NODE(ps_atc2_cio)>; + }; + + DIE_NODE(ps_atc2_cio_usb): power-controller@310 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x310 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc2_cio_usb); + power-domains =3D <&DIE_NODE(ps_atc2_cio)>; + }; + + DIE_NODE(ps_atc3_cio_pcie): power-controller@318 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x318 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc3_cio_pcie); + power-domains =3D <&DIE_NODE(ps_atc3_cio)>; + }; + + DIE_NODE(ps_atc3_cio_usb): power-controller@320 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x320 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc3_cio_usb); + power-domains =3D <&DIE_NODE(ps_atc3_cio)>; + }; + + DIE_NODE(ps_trace_fab): power-controller@390 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x390 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(trace_fab); + }; + + DIE_NODE(ps_ane_sys_mpm): power-controller@4000 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4000 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(ane_sys_mpm); + power-domains =3D <&DIE_NODE(ps_ane_sys)>; + }; + + DIE_NODE(ps_ane_td): power-controller@4008 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4008 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(ane_td); + power-domains =3D <&DIE_NODE(ps_ane_sys)>; + }; + + DIE_NODE(ps_ane_base): power-controller@4010 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4010 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(ane_base); + power-domains =3D <&DIE_NODE(ps_ane_td)>; + }; + + DIE_NODE(ps_ane_set1): power-controller@4018 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4018 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(ane_set1); + power-domains =3D <&DIE_NODE(ps_ane_base)>; + }; + + DIE_NODE(ps_ane_set2): power-controller@4020 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4020 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(ane_set2); + power-domains =3D <&DIE_NODE(ps_ane_set1)>; + }; + + DIE_NODE(ps_ane_set3): power-controller@4028 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4028 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(ane_set3); + power-domains =3D <&DIE_NODE(ps_ane_set2)>; + }; + + DIE_NODE(ps_ane_set4): power-controller@4030 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4030 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(ane_set4); + power-domains =3D <&DIE_NODE(ps_ane_set3)>; + }; +}; + +&DIE_NODE(pmgr_south) { + DIE_NODE(ps_amcc4): power-controller@100 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x100 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(amcc4); + apple,always-on; + }; + + DIE_NODE(ps_amcc5): power-controller@108 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x108 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(amcc5); + apple,always-on; + }; + + DIE_NODE(ps_amcc6): power-controller@110 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x110 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(amcc6); + apple,always-on; + }; + + DIE_NODE(ps_amcc7): power-controller@118 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x118 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(amcc7); + apple,always-on; + }; + + DIE_NODE(ps_dcs_16): power-controller@120 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x120 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_16); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_17): power-controller@128 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x128 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_17); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_18): power-controller@130 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x130 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_18); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_19): power-controller@138 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x138 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_19); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_20): power-controller@140 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x140 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_20); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_21): power-controller@148 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x148 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_21); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_22): power-controller@150 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x150 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_22); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_23): power-controller@158 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x158 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_23); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_24): power-controller@160 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x160 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_24); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_25): power-controller@168 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x168 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_25); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_26): power-controller@170 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x170 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_26); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_27): power-controller@178 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x178 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_27); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_28): power-controller@180 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x180 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_28); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_29): power-controller@188 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x188 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_29); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_30): power-controller@190 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x190 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_30); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_31): power-controller@198 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x198 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_31); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_afnc4_ioa): power-controller@1a0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1a0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc4_ioa); + apple,always-on; /* Apple Fabric */ + power-domains =3D <&DIE_NODE(ps_afi)>; + }; + + DIE_NODE(ps_afnc4_ls): power-controller@1a8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1a8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc4_ls); + apple,always-on; /* Apple Fabric */ + power-domains =3D <&DIE_NODE(ps_afnc4_ioa)>; + }; + + DIE_NODE(ps_afnc4_lw0): power-controller@1b0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1b0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc4_lw0); + apple,always-on; /* Apple Fabric */ + power-domains =3D <&DIE_NODE(ps_afnc4_ls)>; + }; + + DIE_NODE(ps_afnc5_ioa): power-controller@1b8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1b8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc5_ioa); + apple,always-on; /* Apple Fabric */ + power-domains =3D <&DIE_NODE(ps_afi)>; + }; + + DIE_NODE(ps_afnc5_ls): power-controller@1c0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1c0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc5_ls); + apple,always-on; /* Apple Fabric */ + power-domains =3D <&DIE_NODE(ps_afnc5_ioa)>; + }; + + DIE_NODE(ps_afnc5_lw0): power-controller@1c8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1c8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc5_lw0); + apple,always-on; /* Apple Fabric */ + power-domains =3D <&DIE_NODE(ps_afnc5_ls)>; + }; + + DIE_NODE(ps_dispext2_sys): power-controller@1d0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1d0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dispext2_sys); + }; + + DIE_NODE(ps_msr1): power-controller@1d8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1d8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(msr1); + }; + + DIE_NODE(ps_dispext2_fe): power-controller@1e0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1e0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dispext2_fe); + power-domains =3D <&DIE_NODE(ps_dispext2_sys)>; + }; + + DIE_NODE(ps_dispext2_cpu0): power-controller@1e8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1e8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dispext2_cpu0); + power-domains =3D <&DIE_NODE(ps_dispext2_fe)>; + apple,min-state =3D <4>; + }; + + DIE_NODE(ps_msr1_ase_core): power-controller@1f0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1f0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(msr1_ase_core); + power-domains =3D <&DIE_NODE(ps_msr1)>; + }; + + DIE_NODE(ps_dispext3_sys): power-controller@220 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x220 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dispext3_sys); + }; + + DIE_NODE(ps_venc1_sys): power-controller@228 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x228 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(venc1_sys); + }; + + DIE_NODE(ps_dispext3_fe): power-controller@230 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x230 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dispext3_fe); + power-domains =3D <&DIE_NODE(ps_dispext3_sys)>; + }; + + DIE_NODE(ps_dispext3_cpu0): power-controller@238 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x238 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dispext3_cpu0); + power-domains =3D <&DIE_NODE(ps_dispext3_fe)>; + apple,min-state =3D <4>; + }; + + DIE_NODE(ps_venc1_dma): power-controller@4000 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4000 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(venc1_dma); + power-domains =3D <&DIE_NODE(ps_venc1_sys)>; + }; + + DIE_NODE(ps_venc1_pipe4): power-controller@4008 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4008 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(venc1_pipe4); + power-domains =3D <&DIE_NODE(ps_venc1_dma)>; + }; + + DIE_NODE(ps_venc1_pipe5): power-controller@4010 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4010 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(venc1_pipe5); + power-domains =3D <&DIE_NODE(ps_venc1_dma)>; + }; + + DIE_NODE(ps_venc1_me0): power-controller@4018 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4018 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(venc1_me0); + power-domains =3D <&DIE_NODE(ps_venc1_pipe5)>, <&DIE_NODE(ps_venc1_pipe4= )>; + }; + + DIE_NODE(ps_venc1_me1): power-controller@4020 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4020 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(venc1_me1); + power-domains =3D <&DIE_NODE(ps_venc1_me0)>; + }; +}; + +&DIE_NODE(pmgr_east) { + DIE_NODE(ps_clvr_spmi0): power-controller@100 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x100 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(clvr_spmi0); + apple,always-on; /* PCPU voltage regulator interface (used by SMC) */ + }; + + DIE_NODE(ps_clvr_spmi1): power-controller@108 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x108 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(clvr_spmi1); + apple,always-on; /* GPU voltage regulator interface (used by SMC) */ + }; + + DIE_NODE(ps_clvr_spmi2): power-controller@110 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x110 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(clvr_spmi2); + apple,always-on; /* ANE, fabric, AFR voltage regulator interface (used b= y SMC) */ + }; + + DIE_NODE(ps_clvr_spmi3): power-controller@118 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x118 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(clvr_spmi3); + apple,always-on; /* Additional voltage regulator, probably used on T6021= (SMC) */ + }; + + DIE_NODE(ps_clvr_spmi4): power-controller@120 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x120 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(clvr_spmi4); + apple,always-on; /* Additional voltage regulator, probably used on T6021= (SMC) */ + }; + + DIE_NODE(ps_ispsens0): power-controller@128 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x128 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(ispsens0); + }; + + DIE_NODE(ps_ispsens1): power-controller@130 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x130 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(ispsens1); + }; + + DIE_NODE(ps_ispsens2): power-controller@138 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x138 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(ispsens2); + }; + + DIE_NODE(ps_ispsens3): power-controller@140 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x140 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(ispsens3); + }; + + DIE_NODE(ps_afnc6_ioa): power-controller@148 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x148 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc6_ioa); + apple,always-on; + power-domains =3D <&DIE_NODE(ps_afi)>; + }; + + DIE_NODE(ps_afnc6_ls): power-controller@150 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x150 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc6_ls); + apple,always-on; + power-domains =3D <&DIE_NODE(ps_afnc6_ioa)>; + }; + + DIE_NODE(ps_afnc6_lw0): power-controller@158 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x158 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc6_lw0); + apple,always-on; + power-domains =3D <&DIE_NODE(ps_afnc6_ls)>; + }; + + DIE_NODE(ps_afnc2_ioa): power-controller@160 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x160 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc2_ioa); + apple,always-on; + power-domains =3D <&DIE_NODE(ps_dcs_10)>; + }; + + DIE_NODE(ps_afnc2_ls): power-controller@168 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x168 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc2_ls); + apple,always-on; + power-domains =3D <&DIE_NODE(ps_afnc2_ioa)>; + }; + + DIE_NODE(ps_afnc2_lw0): power-controller@170 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x170 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc2_lw0); + apple,always-on; + power-domains =3D <&DIE_NODE(ps_afnc2_ls)>; + }; + + DIE_NODE(ps_afnc2_lw1): power-controller@178 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x178 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc2_lw1); + apple,always-on; + power-domains =3D <&DIE_NODE(ps_afnc2_ls)>; + }; + + DIE_NODE(ps_afnc3_ioa): power-controller@180 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x180 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc3_ioa); + apple,always-on; + power-domains =3D <&DIE_NODE(ps_afi)>; + }; + + DIE_NODE(ps_afnc3_ls): power-controller@188 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x188 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc3_ls); + apple,always-on; + power-domains =3D <&DIE_NODE(ps_afnc3_ioa)>; + }; + + DIE_NODE(ps_afnc3_lw0): power-controller@190 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x190 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afnc3_lw0); + apple,always-on; + power-domains =3D <&DIE_NODE(ps_afnc3_ls)>; + }; + + DIE_NODE(ps_apcie_gp): power-controller@198 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x198 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(apcie_gp); + power-domains =3D <&DIE_NODE(ps_afnc6_lw0)>; + }; + + DIE_NODE(ps_apcie_st): power-controller@1a0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1a0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(apcie_st); + power-domains =3D <&DIE_NODE(ps_afnc6_lw0)>; + }; + + DIE_NODE(ps_ans2): power-controller@1a8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1a8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(ans2); + power-domains =3D <&DIE_NODE(ps_afnc6_lw0)>; + }; + + DIE_NODE(ps_disp0_sys): power-controller@1b0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1b0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(disp0_sys); + power-domains =3D <&DIE_NODE(ps_afnc2_lw0)>; + }; + + DIE_NODE(ps_jpg): power-controller@1b8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1b8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(jpg); + power-domains =3D <&DIE_NODE(ps_afnc2_lw0)>; + }; + + DIE_NODE(ps_sio): power-controller@1c0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1c0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(sio); + power-domains =3D <&DIE_NODE(ps_afnc2_lw1)>; + }; + + DIE_NODE(ps_isp_sys): power-controller@1c8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1c8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(isp_sys); + power-domains =3D <&DIE_NODE(ps_afnc2_lw1)>; + status =3D "disabled"; + }; + + DIE_NODE(ps_disp0_fe): power-controller@1d0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1d0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(disp0_fe); + power-domains =3D <&DIE_NODE(ps_disp0_sys)>; + }; + + DIE_NODE(ps_disp0_cpu0): power-controller@1d8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1d8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(disp0_cpu0); + power-domains =3D <&DIE_NODE(ps_disp0_fe)>; + apple,min-state =3D <4>; + }; + + DIE_NODE(ps_sio_cpu): power-controller@1e0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1e0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(sio_cpu); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_fpwm0): power-controller@1e8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1e8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(fpwm0); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_fpwm1): power-controller@1f0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1f0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(fpwm1); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_fpwm2): power-controller@1f8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x1f8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(fpwm2); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_i2c0): power-controller@200 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x200 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(i2c0); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_i2c1): power-controller@208 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x208 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(i2c1); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_i2c2): power-controller@210 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x210 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(i2c2); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_i2c3): power-controller@218 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x218 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(i2c3); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_i2c4): power-controller@220 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x220 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(i2c4); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_i2c5): power-controller@228 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x228 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(i2c5); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_i2c6): power-controller@230 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x230 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(i2c6); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_i2c7): power-controller@238 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x238 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(i2c7); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_i2c8): power-controller@240 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x240 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(i2c8); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_spi_p): power-controller@248 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x248 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(spi_p); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_sio_spmi0): power-controller@250 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x250 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(sio_spmi0); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_sio_spmi1): power-controller@258 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x258 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(sio_spmi1); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_sio_spmi2): power-controller@260 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x260 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(sio_spmi2); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_uart_p): power-controller@268 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x268 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(uart_p); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_audio_p): power-controller@270 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x270 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(audio_p); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_sio_adma): power-controller@278 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x278 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(sio_adma); + power-domains =3D <&DIE_NODE(ps_audio_p)>, <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_aes): power-controller@280 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x280 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(aes); + apple,always-on; + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_dptx_phy_ps): power-controller@288 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x288 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dptx_phy_ps); + power-domains =3D <&DIE_NODE(ps_sio)>; + }; + + DIE_NODE(ps_spi0): power-controller@2d8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2d8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(spi0); + power-domains =3D <&DIE_NODE(ps_spi_p)>; + }; + + DIE_NODE(ps_spi1): power-controller@2e0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2e0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(spi1); + power-domains =3D <&DIE_NODE(ps_spi_p)>; + }; + + DIE_NODE(ps_spi2): power-controller@2e8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2e8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(spi2); + power-domains =3D <&DIE_NODE(ps_spi_p)>; + }; + + DIE_NODE(ps_spi3): power-controller@2f0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2f0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(spi3); + power-domains =3D <&DIE_NODE(ps_spi_p)>; + }; + + DIE_NODE(ps_spi4): power-controller@2f8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x2f8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(spi4); + power-domains =3D <&DIE_NODE(ps_spi_p)>; + }; + + DIE_NODE(ps_spi5): power-controller@300 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x300 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(spi5); + power-domains =3D <&DIE_NODE(ps_spi_p)>; + }; + + DIE_NODE(ps_uart_n): power-controller@308 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x308 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(uart_n); + power-domains =3D <&DIE_NODE(ps_uart_p)>; + }; + + DIE_NODE(ps_uart0): power-controller@310 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x310 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(uart0); + power-domains =3D <&DIE_NODE(ps_uart_p)>; + }; + + DIE_NODE(ps_amcc1): power-controller@318 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x318 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(amcc1); + apple,always-on; + }; + + DIE_NODE(ps_amcc3): power-controller@320 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x320 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(amcc3); + apple,always-on; + }; + + DIE_NODE(ps_dcs_04): power-controller@328 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x328 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_04); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_05): power-controller@330 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x330 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_05); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_06): power-controller@338 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x338 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_06); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_07): power-controller@340 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x340 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_07); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_12): power-controller@348 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x348 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_12); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_13): power-controller@350 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x350 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_13); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_14): power-controller@358 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x358 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_14); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_dcs_15): power-controller@360 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x360 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dcs_15); + apple,always-on; /* LPDDR5 interface */ + }; + + DIE_NODE(ps_uart1): power-controller@368 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x368 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(uart1); + power-domains =3D <&DIE_NODE(ps_uart_p)>; + }; + + DIE_NODE(ps_uart2): power-controller@370 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x370 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(uart2); + power-domains =3D <&DIE_NODE(ps_uart_p)>; + }; + + DIE_NODE(ps_uart3): power-controller@378 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x378 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(uart3); + power-domains =3D <&DIE_NODE(ps_uart_p)>; + }; + + DIE_NODE(ps_uart4): power-controller@380 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x380 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(uart4); + power-domains =3D <&DIE_NODE(ps_uart_p)>; + }; + + DIE_NODE(ps_uart5): power-controller@388 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x388 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(uart5); + power-domains =3D <&DIE_NODE(ps_uart_p)>; + }; + + DIE_NODE(ps_uart6): power-controller@390 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x390 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(uart6); + power-domains =3D <&DIE_NODE(ps_uart_p)>; + }; + + DIE_NODE(ps_mca0): power-controller@398 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x398 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(mca0); + power-domains =3D <&DIE_NODE(ps_audio_p)>, <&DIE_NODE(ps_sio_adma)>; + }; + + DIE_NODE(ps_mca1): power-controller@3a0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x3a0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(mca1); + power-domains =3D <&DIE_NODE(ps_audio_p)>, <&DIE_NODE(ps_sio_adma)>; + }; + + DIE_NODE(ps_mca2): power-controller@3a8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x3a8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(mca2); + power-domains =3D <&DIE_NODE(ps_audio_p)>, <&DIE_NODE(ps_sio_adma)>; + }; + + DIE_NODE(ps_mca3): power-controller@3b0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x3b0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(mca3); + power-domains =3D <&DIE_NODE(ps_audio_p)>, <&DIE_NODE(ps_sio_adma)>; + }; + + DIE_NODE(ps_dpa0): power-controller@3b8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x3b8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dpa0); + power-domains =3D <&DIE_NODE(ps_audio_p)>; + }; + + DIE_NODE(ps_dpa1): power-controller@3c0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x3c0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dpa1); + power-domains =3D <&DIE_NODE(ps_audio_p)>; + }; + + DIE_NODE(ps_dpa2): power-controller@3c8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x3c8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dpa2); + power-domains =3D <&DIE_NODE(ps_audio_p)>; + }; + + DIE_NODE(ps_dpa3): power-controller@3d0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x3d0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dpa3); + power-domains =3D <&DIE_NODE(ps_audio_p)>; + }; + + DIE_NODE(ps_msr0): power-controller@3d8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x3d8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(msr0); + }; + + DIE_NODE(ps_venc_sys): power-controller@3e0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x3e0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(venc_sys); + }; + + DIE_NODE(ps_dpa4): power-controller@3e8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x3e8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dpa4); + power-domains =3D <&DIE_NODE(ps_audio_p)>; + }; + + DIE_NODE(ps_msr0_ase_core): power-controller@3f0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x3f0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(msr0_ase_core); + power-domains =3D <&DIE_NODE(ps_msr0)>; + }; + + DIE_NODE(ps_apcie_gpshr_sys): power-controller@3f8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x3f8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(apcie_gpshr_sys); + power-domains =3D <&DIE_NODE(ps_apcie_gp)>; + }; + + DIE_NODE(ps_apcie_st_sys): power-controller@408 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x408 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(apcie_st_sys); + power-domains =3D <&DIE_NODE(ps_apcie_st)>, <&DIE_NODE(ps_ans2)>; + }; + + DIE_NODE(ps_apcie_st1_sys): power-controller@410 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x410 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(apcie_st1_sys); + power-domains =3D <&DIE_NODE(ps_apcie_st_sys)>; + }; + + DIE_NODE(ps_apcie_gp_sys): power-controller@418 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x418 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(apcie_gp_sys); + power-domains =3D <&DIE_NODE(ps_apcie_gpshr_sys)>; + apple,always-on; /* Breaks things if shut down */ + }; + + DIE_NODE(ps_apcie_ge_sys): power-controller@420 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x420 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(apcie_ge_sys); + power-domains =3D <&DIE_NODE(ps_apcie_gpshr_sys)>; + }; + + DIE_NODE(ps_apcie_phy_sw): power-controller@428 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x428 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(apcie_phy_sw); + apple,always-on; /* macOS does not turn this off */ + }; + + DIE_NODE(ps_sep): power-controller@c00 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0xc00 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(sep); + apple,always-on; /* Locked on */ + }; + + /* There is a dependency tree involved with these PDs, + * but we do not express it here since the ISP driver + * is supposed to sequence them in the right order anyway. + * + * This also works around spurious parent PD activation + * on machines with ISP disabled (desktops), so we don't + * have to enable/disable everything in the per-model DTs. + */ + DIE_NODE(ps_isp_cpu): power-controller@4000 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4000 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(isp_cpu); + /* power-domains =3D <&DIE_NODE(ps_isp_sys)>; */ + }; + + DIE_NODE(ps_isp_fe): power-controller@4008 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4008 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(isp_fe); + /* power-domains =3D <&DIE_NODE(ps_isp_sys)>; */ + }; + + DIE_NODE(ps_dprx): power-controller@4010 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4010 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(dprx); + /* power-domains =3D <&DIE_NODE(ps_isp_sys)>; */ + }; + + DIE_NODE(ps_isp_vis): power-controller@4018 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4018 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(isp_vis); + /* power-domains =3D <&DIE_NODE(ps_isp_fe)>; */ + }; + + DIE_NODE(ps_isp_be): power-controller@4020 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4020 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(isp_be); + /* power-domains =3D <&DIE_NODE(ps_isp_fe)>; */ + }; + + DIE_NODE(ps_isp_raw): power-controller@4028 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4028 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(isp_raw); + /* power-domains =3D <&DIE_NODE(ps_isp_fe)>; */ + }; + + DIE_NODE(ps_isp_clr): power-controller@4030 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x4030 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(isp_clr); + /* power-domains =3D <&DIE_NODE(ps_isp_be)>; */ + }; + + DIE_NODE(ps_venc_dma): power-controller@8000 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x8000 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(venc_dma); + power-domains =3D <&DIE_NODE(ps_venc_sys)>; + }; + + DIE_NODE(ps_venc_pipe4): power-controller@8008 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x8008 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(venc_pipe4); + power-domains =3D <&DIE_NODE(ps_venc_dma)>; + }; + + DIE_NODE(ps_venc_pipe5): power-controller@8010 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x8010 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(venc_pipe5); + power-domains =3D <&DIE_NODE(ps_venc_dma)>; + }; + + DIE_NODE(ps_venc_me0): power-controller@8018 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x8018 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(venc_me0); + power-domains =3D <&DIE_NODE(ps_venc_pipe5)>, <&DIE_NODE(ps_venc_pipe4)>; + }; + + DIE_NODE(ps_venc_me1): power-controller@8020 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x8020 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(venc_me1); + power-domains =3D <&DIE_NODE(ps_venc_me0)>; + }; + + DIE_NODE(ps_prores): power-controller@c000 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0xc000 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(prores); + power-domains =3D <&DIE_NODE(ps_afnc3_lw0)>; + }; +}; + +&DIE_NODE(pmgr_mini) { + DIE_NODE(ps_debug): power-controller@58 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x58 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(debug); + apple,always-on; /* Core AON device */ + }; + + DIE_NODE(ps_nub_spmi0): power-controller@60 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x60 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(nub_spmi0); + apple,always-on; /* Core AON device */ + }; + + DIE_NODE(ps_nub_spmi1): power-controller@68 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x68 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(nub_spmi1); + apple,always-on; /* Core AON device */ + }; + + DIE_NODE(ps_nub_aon): power-controller@70 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x70 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(nub_aon); + apple,always-on; /* Core AON device */ + }; + + DIE_NODE(ps_msg): power-controller@78 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x78 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(msg); + apple,always-on; /* Core AON device? */ + }; + + DIE_NODE(ps_nub_gpio): power-controller@80 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x80 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(nub_gpio); + apple,always-on; /* Core AON device */ + }; + + DIE_NODE(ps_nub_fabric): power-controller@88 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x88 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(nub_fabric); + apple,always-on; /* Core AON device */ + }; + + DIE_NODE(ps_atc0_usb_aon): power-controller@90 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x90 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc0_usb_aon); + apple,always-on; /* Needs to stay on for dwc3 to work */ + }; + + DIE_NODE(ps_atc1_usb_aon): power-controller@98 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x98 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc1_usb_aon); + apple,always-on; /* Needs to stay on for dwc3 to work */ + }; + + DIE_NODE(ps_atc2_usb_aon): power-controller@a0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0xa0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc2_usb_aon); + apple,always-on; /* Needs to stay on for dwc3 to work */ + }; + + DIE_NODE(ps_atc3_usb_aon): power-controller@a8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0xa8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc3_usb_aon); + apple,always-on; /* Needs to stay on for dwc3 to work */ + }; + + DIE_NODE(ps_mtp_fabric): power-controller@b0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0xb0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(mtp_fabric); + apple,always-on; + power-domains =3D <&DIE_NODE(ps_nub_fabric)>; + status =3D "disabled"; + }; + + DIE_NODE(ps_nub_sram): power-controller@b8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0xb8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(nub_sram); + apple,always-on; /* Core AON device */ + }; + + DIE_NODE(ps_debug_switch): power-controller@c0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0xc0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(debug_switch); + apple,always-on; /* Core AON device */ + }; + + DIE_NODE(ps_atc0_usb): power-controller@c8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0xc8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc0_usb); + power-domains =3D <&DIE_NODE(ps_atc0_common)>; + }; + + DIE_NODE(ps_atc1_usb): power-controller@d0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0xd0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc1_usb); + power-domains =3D <&DIE_NODE(ps_atc1_common)>; + }; + + DIE_NODE(ps_atc2_usb): power-controller@d8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0xd8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc2_usb); + power-domains =3D <&DIE_NODE(ps_atc2_common)>; + }; + + DIE_NODE(ps_atc3_usb): power-controller@e0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0xe0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(atc3_usb); + power-domains =3D <&DIE_NODE(ps_atc3_common)>; + }; + +#if 0 + /* MTP stuff is self-managed */ + DIE_NODE(ps_mtp_gpio): power-controller@e8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0xe8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(mtp_gpio); + apple,always-on; /* MTP always stays on */ + power-domains =3D <&DIE_NODE(ps_mtp_fabric)>; + }; + + DIE_NODE(ps_mtp_base): power-controller@f0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0xf0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(mtp_base); + apple,always-on; /* MTP always stays on */ + power-domains =3D <&DIE_NODE(ps_mtp_fabric)>; + }; + + DIE_NODE(ps_mtp_periph): power-controller@f8 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0xf8 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(mtp_periph); + apple,always-on; /* MTP always stays on */ + power-domains =3D <&DIE_NODE(ps_mtp_fabric)>; + }; + + DIE_NODE(ps_mtp_spi0): power-controller@100 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x100 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(mtp_spi0); + apple,always-on; /* MTP always stays on */ + power-domains =3D <&DIE_NODE(ps_mtp_fabric)>; + }; + + DIE_NODE(ps_mtp_i2cm0): power-controller@108 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x108 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(mtp_i2cm0); + apple,always-on; /* MTP always stays on */ + power-domains =3D <&DIE_NODE(ps_mtp_fabric)>; + }; + + DIE_NODE(ps_mtp_uart0): power-controller@110 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x110 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(mtp_uart0); + apple,always-on; /* MTP always stays on */ + power-domains =3D <&DIE_NODE(ps_mtp_fabric)>; + }; + + DIE_NODE(ps_mtp_cpu): power-controller@118 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x118 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(mtp_cpu); + apple,always-on; /* MTP always stays on */ + power-domains =3D <&DIE_NODE(ps_mtp_fabric)>; + }; + + DIE_NODE(ps_mtp_scm_fabric): power-controller@120 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x120 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(mtp_scm_fabric); + apple,always-on; /* MTP always stays on */ + power-domains =3D <&DIE_NODE(ps_mtp_periph)>; + }; + + DIE_NODE(ps_mtp_sram): power-controller@128 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x128 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(mtp_sram); + apple,always-on; /* MTP always stays on */ + power-domains =3D <&DIE_NODE(ps_mtp_scm_fabric)>, <&DIE_NODE(ps_mtp_cpu)= >; + }; + + DIE_NODE(ps_mtp_dma): power-controller@130 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x130 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(mtp_dma); + apple,always-on; /* MTP always stays on */ + power-domains =3D <&DIE_NODE(ps_mtp_sram)>; + }; +#endif +}; + +&DIE_NODE(pmgr_gfx) { + DIE_NODE(ps_gpx): power-controller@0 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x0 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(gpx); + apple,min-state =3D <4>; + apple,always-on; + }; + + DIE_NODE(ps_afr): power-controller@100 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x100 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(afr); + /* Apple Fabric, media stuff: this can power down */ + apple,min-state =3D <4>; + }; + + DIE_NODE(ps_gfx): power-controller@108 { + compatible =3D "apple,t6020-pmgr-pwrstate", "apple,t8103-pmgr-pwrstate"; + reg =3D <0x108 4>; + #power-domain-cells =3D <0>; + #reset-cells =3D <0>; + label =3D DIE_LABEL(gfx); + power-domains =3D <&DIE_NODE(ps_afr)>, <&DIE_NODE(ps_gpx)>; + }; +}; --=20 2.51.0