From nobody Sun Feb 8 19:32:19 2026 Received: from 10.mo534.mail-out.ovh.net (10.mo534.mail-out.ovh.net [46.105.32.219]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 8B8D430E0E3 for ; Fri, 22 Aug 2025 13:58:47 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=46.105.32.219 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1755871130; cv=none; b=YeggN3LTSUjNrLH/1BHI+cDZWmtAMD60JBlFIE2MEMNi4BA5u9Q7qjwpzhiwQD0mKGlEODGdj+ssd4lr7bdNCZ1dCTQbHs1D2cxjvBqnHrMvwLds2h8iQaFY60ZpAEbQ0SWLaisFhruiV6mT1OEOiv5xxQEllHTFGMbCNAiBcvk= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1755871130; c=relaxed/simple; bh=I2+ooCH66VdkjAu2Ze3eP4vpjnffGHDacRvjoxxTVaY=; h=From:To:Cc:Subject:Date:Message-Id:In-Reply-To:References: MIME-Version; b=rbwHHlB98GubaDh/5JootQB/NK0TQtb6W/9umVNBC/Ef2SbjB3xeTwaYprhmwL8dy4b/6hVy4gWNChchI5lXr5ByHv/HN4e7dn+j2VeGSaCv8ZKQcSemYD+29yV6J2xOkoKFQx1DKng6+7R9w0bYneRvomv7DC3QmckDH31AJFk= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=orca.pet; spf=pass smtp.mailfrom=orca.pet; dkim=pass (2048-bit key) header.d=orca.pet header.i=@orca.pet header.b=X1ZFhVeg; arc=none smtp.client-ip=46.105.32.219 Authentication-Results: smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=orca.pet Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=orca.pet Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=orca.pet header.i=@orca.pet header.b="X1ZFhVeg" Received: from director4.derp.mail-out.ovh.net (director4.derp.mail-out.ovh.net [79.137.60.37]) by mo534.mail-out.ovh.net (Postfix) with ESMTPS id 4c7hcH3ybvz6ByC; Fri, 22 Aug 2025 13:58:39 +0000 (UTC) Received: from director4.derp.mail-out.ovh.net (director4.derp.mail-out.ovh.net. [127.0.0.1]) by director4.derp.mail-out.ovh.net (inspect_sender_mail_agent) with SMTP for ; Fri, 22 Aug 2025 13:58:39 +0000 (UTC) Received: from mta2.priv.ovhmail-u1.ea.mail.ovh.net (unknown [10.110.164.55]) by director4.derp.mail-out.ovh.net (Postfix) with ESMTPS id 4c7hcH2WNbz1yGR; Fri, 22 Aug 2025 13:58:39 +0000 (UTC) Received: from orca.pet (unknown [10.1.6.4]) by mta2.priv.ovhmail-u1.ea.mail.ovh.net (Postfix) with ESMTPSA id 5F0633E32CF; Fri, 22 Aug 2025 13:58:38 +0000 (UTC) Authentication-Results: garm.ovh; auth=pass (GARM-95G00193c9e7f0-3e02-4c96-8053-d7a721d83764, ADC0680FE15BB91110492B9A34CE42AA242C155A) smtp.auth=marcos@orca.pet X-OVh-ClientIp: 147.156.42.5 From: Marcos Del Sol Vives To: linux-kernel@vger.kernel.org Cc: Marcos Del Sol Vives , Linus Walleij , Bartosz Golaszewski , Michael Walle , Lee Jones , Bjorn Helgaas , linux-gpio@vger.kernel.org, linux-pci@vger.kernel.org Subject: [PATCH v4 2/3] gpio: vortex: add new GPIO device driver Date: Fri, 22 Aug 2025 15:58:12 +0200 Message-Id: <20250822135816.739582-3-marcos@orca.pet> X-Mailer: git-send-email 2.34.1 In-Reply-To: <20250822135816.739582-1-marcos@orca.pet> References: <20250822135816.739582-1-marcos@orca.pet> Precedence: bulk X-Mailing-List: linux-kernel@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-Ovh-Tracer-Id: 8615104614398383718 X-VR-SPAMSTATE: OK X-VR-SPAMSCORE: -100 X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeeffedrtdefgdduieefleegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuqfggjfdpvefjgfevmfevgfenuceurghilhhouhhtmecuhedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkofgjfhgggfestdekredtredttdenucfhrhhomhepofgrrhgtohhsucffvghlucfuohhlucggihhvvghsuceomhgrrhgtohhssehorhgtrgdrphgvtheqnecuggftrfgrthhtvghrnhepjefhtddukedtjedttdejhfekgeetgeetudelheeghfduffeiveekgfehhfekjedunecuffhomhgrihhnpehvohhrthgvgiekiedrtghomhenucfkphepuddvjedrtddrtddruddpudegjedrudehiedrgedvrdehnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepuddvjedrtddrtddruddpmhgrihhlfhhrohhmpehmrghrtghoshesohhrtggrrdhpvghtpdhnsggprhgtphhtthhopeelpdhrtghpthhtohepsghrghhlsegsghguvghvrdhplhdprhgtphhtthhopegshhgvlhhgrggrshesghhoohhglhgvrdgtohhmpdhrtghpthhtoheplhgvvgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepmhifrghllhgvsehkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhhsrdifrghllhgvihhjsehlihhnrghrohdrohhrghdprhgtphhtthhopehmrghrtghoshesohhrtggrrdhpvghtpdhrtghpthhtoheplhhinh hugidqghhpihhosehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphgtihesvhhgvghrrdhkvghrnhgvlhdrohhrgh DKIM-Signature: a=rsa-sha256; bh=+ddC6/C+4PiskoWM7HBtyuAMn3NQyUw8QTC7ohXcGxA=; c=relaxed/relaxed; d=orca.pet; h=From; s=ovhmo-selector-1; t=1755871119; v=1; b=X1ZFhVegygBtdgZiV99FaouYtYLuwjtKIrOkVUEtuOUnB9ihybHA9Hi1l2anmGBanr1BSFxn 8nmIwv8uYRphhQ1P8uzBf8GdkLxPW62NC75kYlA/K9Ep8aoPaAI1YZkdSxQWZiCY1/vT0RiGryI FqF1raZoOuSEAt9ba//Rx+Lokp+tG0PohRm5Kh9xjZIS9chFnnOjbioOF3hLuvHtrM3oYfvnY9z JaPd1lEGa/0zFFQqLX81wmIOcMNSZdvSaZG35EoseUV3lYLevJh1IlvaTQCx0ubU1mEysp/fT5d zuKpaD1A7D8nN4x49+E1XLK/x3Ir1xnzr2PSKLRfXhPmA== Content-Type: text/plain; charset="utf-8" Add a new simple GPIO device driver for most DM&P Vortex86 SoCs, implemented according to their programming reference manuals [1][2][3]. Vortex86EX/EX2 use a radically different mechanism of GPIO control and are not supported by this driver. This is required for detecting the status of the poweroff button and performing the poweroff sequence on ICOP eBox computers. IRQs are not implemented, as they are only available for ports 0 and 1, none which are accessible on my test machine (an EBOX-3352-GLW). [1]: https://www.vortex86.com/downloadsStart?serial=3DVortex86SX/DX/MXPLUS [2]: https://www.vortex86.com/downloadsStart?serial=3DVortex86DX2 [3]: https://www.vortex86.com/downloadsStart?serial=3DVortex86DX3 Signed-off-by: Marcos Del Sol Vives Acked-by: William Breathitt Gray --- MAINTAINERS | 5 ++ drivers/gpio/Kconfig | 13 +++ drivers/gpio/Makefile | 1 + drivers/gpio/gpio-vortex.c | 170 +++++++++++++++++++++++++++++++++++++ 4 files changed, 189 insertions(+) create mode 100644 drivers/gpio/gpio-vortex.c diff --git a/MAINTAINERS b/MAINTAINERS index 2720544cd91f..afa88f446630 100644 --- a/MAINTAINERS +++ b/MAINTAINERS @@ -26953,6 +26953,11 @@ VOLTAGE AND CURRENT REGULATOR IRQ HELPERS R: Matti Vaittinen F: drivers/regulator/irq_helpers.c =20 +VORTEX HARDWARE SUPPORT +R: Marcos Del Sol Vives +S: Maintained +F: drivers/gpio/gpio-vortex.c + VRF M: David Ahern L: netdev@vger.kernel.org diff --git a/drivers/gpio/Kconfig b/drivers/gpio/Kconfig index e43abb322fa6..dd5b24843b41 100644 --- a/drivers/gpio/Kconfig +++ b/drivers/gpio/Kconfig @@ -1077,6 +1077,19 @@ config GPIO_TS5500 blocks of the TS-5500: DIO1, DIO2 and the LCD port, and the TS-5600 LCD port. =20 +config GPIO_VORTEX + tristate "Vortex SoC GPIO support" + select REGMAP_MMIO + select GPIO_REGMAP + help + Driver to access the 8-bit bidirectional GPIO ports present on DM&P + Vortex86SX/MX/MX+/DX/DX2/DX3 SoCs. + + Vortex86EX-series parts are not supported. + + To compile this driver as a module, choose M here: the module will + be called gpio-vortex. + config GPIO_WINBOND tristate "Winbond Super I/O GPIO support" select ISA_BUS_API diff --git a/drivers/gpio/Makefile b/drivers/gpio/Makefile index 379f55e9ed1e..7b8626c9bd75 100644 --- a/drivers/gpio/Makefile +++ b/drivers/gpio/Makefile @@ -197,6 +197,7 @@ obj-$(CONFIG_GPIO_VIPERBOARD) +=3D gpio-viperboard.o obj-$(CONFIG_GPIO_VIRTUSER) +=3D gpio-virtuser.o obj-$(CONFIG_GPIO_VIRTIO) +=3D gpio-virtio.o obj-$(CONFIG_GPIO_VISCONTI) +=3D gpio-visconti.o +obj-$(CONFIG_GPIO_VORTEX) +=3D gpio-vortex.o obj-$(CONFIG_GPIO_VX855) +=3D gpio-vx855.o obj-$(CONFIG_GPIO_WCD934X) +=3D gpio-wcd934x.o obj-$(CONFIG_GPIO_WHISKEY_COVE) +=3D gpio-wcove.o diff --git a/drivers/gpio/gpio-vortex.c b/drivers/gpio/gpio-vortex.c new file mode 100644 index 000000000000..edac919a5799 --- /dev/null +++ b/drivers/gpio/gpio-vortex.c @@ -0,0 +1,170 @@ +// SPDX-License-Identifier: GPL-2.0-only +/* + * GPIO driver for Vortex86 SoCs + * + * Vortex SoCs may have either a single set (DX/MX/SX) of data/direction p= orts, + * or two non-contiguous sets (DX2/DX3). + * + * Because gpio-regmap is not designed to handle ranges with holes of arbi= trary + * sizes in them, this driver reports a virtual layout where ports 0..n-1 = are + * data ports, and n..n*2-1 are direction ports. The xlate function then m= aps + * these virtual ports back to the real hardware registers relative to the + * requested I/O window. + * + * Author: Marcos Del Sol Vives + */ + +#include +#include +#include +#include +#include +#include +#include +#include + +struct vortex_gpio { + struct regmap_range ranges[4]; + struct regmap_access_table access_table; + struct device *dev; +}; + +static int vortex_gpio_xlate(struct gpio_regmap *gpio, unsigned int base, + unsigned int offset, unsigned int *reg, + unsigned int *mask) +{ + struct vortex_gpio *priv =3D gpio_regmap_get_drvdata(gpio); + unsigned int virtual_port, r_min, r_size; + int i; + + virtual_port =3D base + offset / 8; + + for (i =3D 0; i < priv->access_table.n_yes_ranges; i++) { + r_min =3D priv->ranges[i].range_min; + r_size =3D priv->ranges[i].range_max - r_min + 1; + + if (virtual_port < r_size) { + *reg =3D virtual_port + r_min; + *mask =3D BIT(offset % 8); + return 0; + } + virtual_port -=3D r_size; + } + + /* should never happen */ + dev_err(priv->dev, "tried to translate an out-of-bounds virtual port: %u\= n", + base + offset / 8); + return -EINVAL; +} + +static int vortex_gpio_add_range(struct vortex_gpio *priv, + struct platform_device *pdev, + const char *res_name) +{ + struct resource *res; + + res =3D platform_get_resource_byname(pdev, IORESOURCE_IO, res_name); + if (!res) + return 0; + + priv->ranges[priv->access_table.n_yes_ranges].range_min =3D res->start; + priv->ranges[priv->access_table.n_yes_ranges].range_max =3D res->end; + priv->access_table.n_yes_ranges++; + + return resource_size(res); +} + +static int vortex_gpio_probe(struct platform_device *pdev) +{ + struct gpio_regmap_config gpiocfg =3D {}; + struct device *dev =3D &pdev->dev; + struct regmap_config rmcfg =3D {}; + unsigned long io_min, io_max; + struct vortex_gpio *priv; + int i, dat_len, dir_len; + struct regmap *map; + void __iomem *regs; + + /* Initialize private data */ + priv =3D devm_kzalloc(dev, sizeof(struct vortex_gpio), + GFP_KERNEL); + if (unlikely(!priv)) + return -ENOMEM; + priv->dev =3D dev; + priv->access_table.yes_ranges =3D priv->ranges; + + /* Add I/O ports from platform data to ranges */ + dat_len =3D vortex_gpio_add_range(priv, pdev, "dat1"); + if (unlikely(!dat_len)) { + dev_err(dev, "failed to get data register\n"); + return -ENODEV; + } + dat_len +=3D vortex_gpio_add_range(priv, pdev, "dat2"); + + dir_len =3D vortex_gpio_add_range(priv, pdev, "dir1"); + if (unlikely(!dir_len)) { + dev_err(dev, "failed to get direction register\n"); + return -ENODEV; + } + dir_len +=3D vortex_gpio_add_range(priv, pdev, "dir2"); + + if (unlikely(dat_len !=3D dir_len)) { + dev_err(dev, "data and direction size mismatch (%d vs %d)\n", + dat_len, dir_len); + return -EINVAL; + } + + /* Request smallest I/O window that covers all registers */ + io_min =3D priv->ranges[0].range_min; + io_max =3D priv->ranges[0].range_max; + for (i =3D 1; i < priv->access_table.n_yes_ranges; i++) { + io_min =3D min(io_min, priv->ranges[i].range_min); + io_max =3D max(io_max, priv->ranges[i].range_max); + } + + regs =3D devm_ioport_map(dev, io_min, io_max - io_min + 1); + if (unlikely(!regs)) + return -ENOMEM; + + /* Subtract io_min to make them relative to the window */ + for (i =3D 0; i < priv->access_table.n_yes_ranges; i++) { + priv->ranges[i].range_min -=3D io_min; + priv->ranges[i].range_max -=3D io_min; + } + + rmcfg.reg_bits =3D 8; + rmcfg.val_bits =3D 8; + rmcfg.io_port =3D true; + rmcfg.wr_table =3D &priv->access_table; + rmcfg.rd_table =3D &priv->access_table; + + map =3D devm_regmap_init_mmio(dev, regs, &rmcfg); + if (IS_ERR(map)) + return dev_err_probe(dev, PTR_ERR(map), + "Unable to initialize register map\n"); + + gpiocfg.parent =3D dev; + gpiocfg.regmap =3D map; + gpiocfg.drvdata =3D priv; + gpiocfg.ngpio =3D 8 * dat_len; + gpiocfg.ngpio_per_reg =3D 8; + gpiocfg.reg_dat_base =3D GPIO_REGMAP_ADDR(0); + gpiocfg.reg_set_base =3D GPIO_REGMAP_ADDR(0); + gpiocfg.reg_dir_out_base =3D GPIO_REGMAP_ADDR(dat_len); + gpiocfg.flags =3D GPIO_REGMAP_DIR_BEFORE_SET; + gpiocfg.reg_mask_xlate =3D vortex_gpio_xlate; + + return PTR_ERR_OR_ZERO(devm_gpio_regmap_register(dev, &gpiocfg)); +} + +static struct platform_driver vortex_gpio_driver =3D { + .driver.name =3D "vortex-gpio", + .probe =3D vortex_gpio_probe, +}; + +module_platform_driver(vortex_gpio_driver); + +MODULE_AUTHOR("Marcos Del Sol Vives "); +MODULE_DESCRIPTION("GPIO driver for Vortex86 SoCs"); +MODULE_LICENSE("GPL"); +MODULE_ALIAS("platform:vortex-gpio"); --=20 2.34.1