From nobody Tue Feb 10 11:40:05 2026 Received: from relay5-d.mail.gandi.net (relay5-d.mail.gandi.net [217.70.183.197]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 787902DBF7E; Tue, 17 Jun 2025 12:12:26 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=217.70.183.197 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1750162349; cv=none; b=UsBQIGstGZ/BtuKsAY6OAXc1ZgrLGL81VOZB3w4+gKBtfxvWMq18VJN8WB5KSa0lscTdpCi0qmAW+f0Lq+38IBfMAIemQc4JAXIkfBzTCsVv+YHaMglYK6o9qlrVXwyMPx2qBTNe8dccGcTMl02ApJum0V0YQdYXriAlRSAfE6g= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1750162349; c=relaxed/simple; bh=vzXuKOSsKRAavZBVX6WY+7mR2H+F/LPeSEAWOTu/4WA=; h=From:Date:Subject:MIME-Version:Content-Type:Message-Id:References: In-Reply-To:To:Cc; b=K2GFauqb2QpPAzPLgL81K8JawfBq1CQ5YOirILc1CJo8ljKIoCpxJz4nRf4KKnOw716EzDPv1jJyyMWR48ktmLYF5m3RxcuGPutpEUEL89Vu0/nG/oHEkxwmWadMlJIeSfRFtvJexCZQ0Cg1nipQu5osW0vsfhNki31tMxqyZII= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com; spf=pass smtp.mailfrom=bootlin.com; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b=b4twS8Lg; arc=none smtp.client-ip=217.70.183.197 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=bootlin.com Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b="b4twS8Lg" Received: by mail.gandi.net (Postfix) with ESMTPSA id 0306B439F1; Tue, 17 Jun 2025 12:12:17 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1750162339; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=aJp1L2JMIyWyFRAe2oZ8qYnyDYgNSLUvQHYZYkpxQrI=; b=b4twS8Lg9WMaleUPPhJfaPhKmuXtRjTqpQ2skfjNgyFa6q3dUs3Jkx5KzsBA3FyK8NEA1l 5Z/iSeM8ULpzAV05X/no7lW7sEE60rKhf+TL3zyWjtL88LmM2Zw4Lbb4LlML+VZ9q0mIED MoHRKLNMd5kW46HsU9AddjUg6Y3HP0NIBHmLAJQLHjddcKuN6fBuTtGo18koGmaHCod/hJ IIn7Bwgi4g0mgT65IOJpWxSRPPNT6p8CCb6dnt+vnUIYOL9wBNMtoWh5aje25mFBDyoz4t Kpr+YVSDE9TWXAc20zjQ1BLDY0SRVKPINZcgBFdhwMUuqND2vO94Cu63IQK41g== From: Kory Maincent Date: Tue, 17 Jun 2025 14:12:03 +0200 Subject: [PATCH net-next v14 04/13] net: pse-pd: Add support for PSE power domains Precedence: bulk X-Mailing-List: linux-kernel@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Message-Id: <20250617-feature_poe_port_prio-v14-4-78a1a645e2ee@bootlin.com> References: <20250617-feature_poe_port_prio-v14-0-78a1a645e2ee@bootlin.com> In-Reply-To: <20250617-feature_poe_port_prio-v14-0-78a1a645e2ee@bootlin.com> To: Andrew Lunn , Oleksij Rempel , "David S. Miller" , Eric Dumazet , Jakub Kicinski , Paolo Abeni , Jonathan Corbet , Donald Hunter , Rob Herring , Andrew Lunn , Simon Horman , Heiner Kallweit , Russell King , Krzysztof Kozlowski , Conor Dooley Cc: Liam Girdwood , Mark Brown , Thomas Petazzoni , netdev@vger.kernel.org, linux-doc@vger.kernel.org, Kyle Swenson , Dent Project , kernel@pengutronix.de, Maxime Chevallier , devicetree@vger.kernel.org, linux-kernel@vger.kernel.org, "Kory Maincent (Dent Project)" X-Mailer: b4 0.15-dev-8cb71 X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtddvgddugecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfitefpfffkpdcuggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephfffufggtgfgkfhfjgfvvefosehtjeertdertdejnecuhfhrohhmpefmohhrhicuofgrihhntggvnhhtuceokhhorhihrdhmrghinhgtvghnthessghoohhtlhhinhdrtghomheqnecuggftrfgrthhtvghrnhepvefgvdfgkeetgfefgfegkedugffghfdtffeftdeuteehjedtvdelvddvleehtdevnecukfhppeeltddrkeelrdduieefrdduvdejnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepledtrdekledrudeifedruddvjedphhgvlhhopegluddvjedrtddruddrudgnpdhmrghilhhfrhhomhepkhhorhihrdhmrghinhgtvghnthessghoohhtlhhinhdrtghomhdpnhgspghrtghpthhtohepvdejpdhrtghpthhtohepuggrvhgvmhesuggrvhgvmhhlohhfthdrnhgvthdprhgtphhtthhopehkohhrhidrmhgrihhntggvnhhtsegsohhothhlihhnrdgtohhmpdhrtghpthhtohepmhgrgihimhgvrdgthhgvvhgrlhhlihgvrhessghoohhtlhhinhdrtghomhdprhgtphhtthhopehprggsvghnihesrhgvughhrghtrdgtohhmpdhrtghpthhtoheptghonhhorhdoughtsehkvghrnhgvlhdrohhrghdpr hgtphhtthhopehkuhgsrgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqughotgesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehkhihlvgdrshifvghnshhonhesvghsthdrthgvtghh X-GND-Sasl: kory.maincent@bootlin.com From: Kory Maincent (Dent Project) Introduce PSE power domain support as groundwork for upcoming port priority features. Multiple PSE PIs can now be grouped under a single PSE power domain, enabling future enhancements like defining available power budgets, port priority modes, and disconnection policies. This setup will allow the system to assess whether activating a port would exceed the available power budget, preventing over-budget states proactively. Signed-off-by: Kory Maincent (Dent Project) Reviewed-by: Oleksij Rempel --- Changes in v14: - Forgot to release the pse_pw_d_mutex in __pse_pw_d_release. Changes in v8: - Add missing kref_init and an wrong error check condition. Changes in v7: - Add reference count and mutex lock for PSE power domain in case of PSE from different controllers want to register the same PSE power domain. Changes in v6: - nitpick change. Changes in v4: - Add kdoc. - Fix null dereference in pse_flush_pw_ds function. Changes in v3: - Remove pw_budget variable. Changes in v2: - new patch. --- drivers/net/pse-pd/pse_core.c | 140 ++++++++++++++++++++++++++++++++++++++= ++++ include/linux/pse-pd/pse.h | 2 + 2 files changed, 142 insertions(+) diff --git a/drivers/net/pse-pd/pse_core.c b/drivers/net/pse-pd/pse_core.c index 16cc1dc07246..f2fb7ccbc4c2 100644 --- a/drivers/net/pse-pd/pse_core.c +++ b/drivers/net/pse-pd/pse_core.c @@ -16,8 +16,12 @@ #include #include =20 +#define PSE_PW_D_LIMIT INT_MAX + static DEFINE_MUTEX(pse_list_mutex); static LIST_HEAD(pse_controller_list); +static DEFINE_XARRAY_ALLOC(pse_pw_d_map); +static DEFINE_MUTEX(pse_pw_d_mutex); =20 /** * struct pse_control - a PSE control @@ -38,6 +42,18 @@ struct pse_control { struct phy_device *attached_phydev; }; =20 +/** + * struct pse_power_domain - a PSE power domain + * @id: ID of the power domain + * @supply: Power supply the Power Domain + * @refcnt: Number of gets of this pse_power_domain + */ +struct pse_power_domain { + int id; + struct regulator *supply; + struct kref refcnt; +}; + static int of_load_single_pse_pi_pairset(struct device_node *node, struct pse_pi *pi, int pairset_num) @@ -485,6 +501,125 @@ devm_pse_pi_regulator_register(struct pse_controller_= dev *pcdev, return 0; } =20 +static void __pse_pw_d_release(struct kref *kref) +{ + struct pse_power_domain *pw_d =3D container_of(kref, + struct pse_power_domain, + refcnt); + + regulator_put(pw_d->supply); + xa_erase(&pse_pw_d_map, pw_d->id); + mutex_unlock(&pse_pw_d_mutex); +} + +/** + * pse_flush_pw_ds - flush all PSE power domains of a PSE + * @pcdev: a pointer to the initialized PSE controller device + */ +static void pse_flush_pw_ds(struct pse_controller_dev *pcdev) +{ + struct pse_power_domain *pw_d; + int i; + + for (i =3D 0; i < pcdev->nr_lines; i++) { + if (!pcdev->pi[i].pw_d) + continue; + + pw_d =3D xa_load(&pse_pw_d_map, pcdev->pi[i].pw_d->id); + if (!pw_d) + continue; + + kref_put_mutex(&pw_d->refcnt, __pse_pw_d_release, + &pse_pw_d_mutex); + } +} + +/** + * devm_pse_alloc_pw_d - allocate a new PSE power domain for a device + * @dev: device that is registering this PSE power domain + * + * Return: Pointer to the newly allocated PSE power domain or error pointe= rs + */ +static struct pse_power_domain *devm_pse_alloc_pw_d(struct device *dev) +{ + struct pse_power_domain *pw_d; + int index, ret; + + pw_d =3D devm_kzalloc(dev, sizeof(*pw_d), GFP_KERNEL); + if (!pw_d) + return ERR_PTR(-ENOMEM); + + ret =3D xa_alloc(&pse_pw_d_map, &index, pw_d, XA_LIMIT(1, PSE_PW_D_LIMIT), + GFP_KERNEL); + if (ret) + return ERR_PTR(ret); + + kref_init(&pw_d->refcnt); + pw_d->id =3D index; + return pw_d; +} + +/** + * pse_register_pw_ds - register the PSE power domains for a PSE + * @pcdev: a pointer to the PSE controller device + * + * Return: 0 on success and failure value on error + */ +static int pse_register_pw_ds(struct pse_controller_dev *pcdev) +{ + int i, ret =3D 0; + + mutex_lock(&pse_pw_d_mutex); + for (i =3D 0; i < pcdev->nr_lines; i++) { + struct regulator_dev *rdev =3D pcdev->pi[i].rdev; + struct pse_power_domain *pw_d; + struct regulator *supply; + bool present =3D false; + unsigned long index; + + /* No regulator or regulator parent supply registered. + * We need a regulator parent to register a PSE power domain + */ + if (!rdev || !rdev->supply) + continue; + + xa_for_each(&pse_pw_d_map, index, pw_d) { + /* Power supply already registered as a PSE power + * domain. + */ + if (regulator_is_equal(pw_d->supply, rdev->supply)) { + present =3D true; + pcdev->pi[i].pw_d =3D pw_d; + break; + } + } + if (present) { + kref_get(&pw_d->refcnt); + continue; + } + + pw_d =3D devm_pse_alloc_pw_d(pcdev->dev); + if (IS_ERR(pw_d)) { + ret =3D PTR_ERR(pw_d); + goto out; + } + + supply =3D regulator_get(&rdev->dev, rdev->supply_name); + if (IS_ERR(supply)) { + xa_erase(&pse_pw_d_map, pw_d->id); + ret =3D PTR_ERR(supply); + goto out; + } + + pw_d->supply =3D supply; + pcdev->pi[i].pw_d =3D pw_d; + } + +out: + mutex_unlock(&pse_pw_d_mutex); + return ret; +} + /** * pse_controller_register - register a PSE controller device * @pcdev: a pointer to the initialized PSE controller device @@ -544,6 +679,10 @@ int pse_controller_register(struct pse_controller_dev = *pcdev) return ret; } =20 + ret =3D pse_register_pw_ds(pcdev); + if (ret) + return ret; + mutex_lock(&pse_list_mutex); list_add(&pcdev->list, &pse_controller_list); mutex_unlock(&pse_list_mutex); @@ -558,6 +697,7 @@ EXPORT_SYMBOL_GPL(pse_controller_register); */ void pse_controller_unregister(struct pse_controller_dev *pcdev) { + pse_flush_pw_ds(pcdev); pse_release_pis(pcdev); mutex_lock(&pse_list_mutex); list_del(&pcdev->list); diff --git a/include/linux/pse-pd/pse.h b/include/linux/pse-pd/pse.h index 6eb064722aa8..f736b1677ea5 100644 --- a/include/linux/pse-pd/pse.h +++ b/include/linux/pse-pd/pse.h @@ -222,12 +222,14 @@ struct pse_pi_pairset { * @np: device node pointer of the PSE PI node * @rdev: regulator represented by the PSE PI * @admin_state_enabled: PI enabled state + * @pw_d: Power domain of the PSE PI */ struct pse_pi { struct pse_pi_pairset pairset[2]; struct device_node *np; struct regulator_dev *rdev; bool admin_state_enabled; + struct pse_power_domain *pw_d; }; =20 /** --=20 2.43.0