From nobody Wed Dec 17 07:32:11 2025 Received: from relay7-d.mail.gandi.net (relay7-d.mail.gandi.net [217.70.183.200]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 1BAEC21D3EA; Wed, 16 Apr 2025 13:44:57 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=217.70.183.200 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1744811101; cv=none; b=ewayR8MVc6crmKHZrhIPMY3UQgRgINM9/7+TyAbeOLBsKvjqpyBWZDmwikxD3T4nUJGlXwf44yQ4nabEnD9OUrnb5tYZS9hfdKrJKBtSGqhUM6VUdDfPGclXRpHSpAf3qA1fY8+e+2cQBuDTxHvlWWjbThZgFuJTbJs0paJHhVQ= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1744811101; c=relaxed/simple; bh=kGsXN25MF5gR2Dcb6V434fYrrb46r5vmJ176my5Zc04=; h=From:Date:Subject:MIME-Version:Content-Type:Message-Id:References: In-Reply-To:To:Cc; b=uzc0w1DdvIjTnnUzWaJvXdSUbJhTPC2koeT2xyh3258jGq6CzP+wPD6951mSUkx7opielGdI/esKioW9jfU7faghl+Xt14kivb7j9o78tAWhnNzIriUCKUvKoBnZLrH8JB0a3RBiiKsONm76fNPrFdqoZ+s9NDfcy9Js6KceN4w= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com; spf=pass smtp.mailfrom=bootlin.com; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b=Njpc/sqN; arc=none smtp.client-ip=217.70.183.200 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=bootlin.com Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b="Njpc/sqN" Received: by mail.gandi.net (Postfix) with ESMTPSA id 0FC7543903; Wed, 16 Apr 2025 13:44:55 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1744811096; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=D7XsMAZ/bY3AXgiHfs0mec7RZx05gzFYeVzX97wp8Gk=; b=Njpc/sqNqFY3ArTeTrlEga+z2v5dTWBZmW7yVEswJqkomgy5KBbiknRL7pSPgnRWVu3gkB iVQb9KFPv0Zwwhudx+6Hj0aNGHXJClut0Y/5nqZ2Mey+/XlrEVzGccwoCNyvEVQ3F6kcGY mNMo8m/x3/8IAZzaZRplJjtlqfhus5s6Lrqnhjh992XrTFxchncUk+wpeSMAsKJXVUl502 seWO4xbcCayOF+91fBd9DKEw/m7+y77+pVgG3w+atZkbU7R1DLNTKiox2a0r6nEqHrYzi2 xA1HHA+e5633/KyItXKr11z9IB3qLaECjjzAjwkgAI+dBv9HQvbpEstlZ+HEeg== From: Kory Maincent Date: Wed, 16 Apr 2025 15:44:23 +0200 Subject: [PATCH net-next v8 08/13] net: ethtool: Add PSE port priority support feature Precedence: bulk X-Mailing-List: linux-kernel@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: quoted-printable Message-Id: <20250416-feature_poe_port_prio-v8-8-446c39dc3738@bootlin.com> References: <20250416-feature_poe_port_prio-v8-0-446c39dc3738@bootlin.com> In-Reply-To: <20250416-feature_poe_port_prio-v8-0-446c39dc3738@bootlin.com> To: Andrew Lunn , Oleksij Rempel , "David S. Miller" , Eric Dumazet , Jakub Kicinski , Paolo Abeni , Jonathan Corbet , Donald Hunter , Rob Herring , Andrew Lunn , Simon Horman , Heiner Kallweit , Russell King , Krzysztof Kozlowski , Conor Dooley Cc: Liam Girdwood , Mark Brown , Thomas Petazzoni , netdev@vger.kernel.org, linux-doc@vger.kernel.org, Kyle Swenson , Dent Project , kernel@pengutronix.de, Maxime Chevallier , devicetree@vger.kernel.org, linux-kernel@vger.kernel.org, "Kory Maincent (Dent Project)" X-Mailer: b4 0.15-dev-8cb71 X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgddvvdeiheefucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuifetpfffkfdpucggtfgfnhhsuhgsshgtrhhisggvnecuuegrihhlohhuthemuceftddunecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhfffugggtgffkfhgjvfevofesthejredtredtjeenucfhrhhomhepmfhorhihucforghinhgtvghnthcuoehkohhrhidrmhgrihhntggvnhhtsegsohhothhlihhnrdgtohhmqeenucggtffrrghtthgvrhhnpeevgfdvgfektefgfefggeekudfggffhtdfffedtueetheejtddvledvvdelhedtveenucfkphepledtrdekledrudeifedruddvjeenucevlhhushhtvghrufhiiigvpeehnecurfgrrhgrmhepihhnvghtpeeltddrkeelrdduieefrdduvdejpdhhvghloheplgduvdejrddtrddurddungdpmhgrihhlfhhrohhmpehkohhrhidrmhgrihhntggvnhhtsegsohhothhlihhnrdgtohhmpdhnsggprhgtphhtthhopedvjedprhgtphhtthhopehrohgshheskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepkhhusggrsehkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghvvghmsegurghvvghmlhhofhhtrdhnvghtpdhrtghpthhtohephhhkrghllhifvghithdusehgmhgrihhlrdgtohhmpdhrtghpthhtohepkhgvrhhnvghlsehpvghnghhuthhrohhnihigrdguvgdprhgtphhtthhopehhohhrmhhssehkvghrn hgvlhdrohhrghdprhgtphhtthhopehordhrvghmphgvlhesphgvnhhguhhtrhhonhhigidruggvpdhrtghpthhtohepughonhgrlhgurdhhuhhnthgvrhesghhmrghilhdrtghomh X-GND-Sasl: kory.maincent@bootlin.com From: Kory Maincent (Dent Project) This patch expands the status information provided by ethtool for PSE c33 with current port priority and max port priority. It also adds a call to pse_ethtool_set_prio() to configure the PSE port priority. Signed-off-by: Kory Maincent (Dent Project) Reviewed-by: Oleksij Rempel --- Change in v6: - Remove c33 standard reference from new netlink field in documentation. - Remove report of budget evaluation strategy. Change in v4: - Remove disconnection policy features. - Rename port priority to budget evaluation strategy. Change in v3: - Add disconnection policy. Change in v2: - Improve port priority documentation. - Add port priority modes. --- Documentation/netlink/specs/ethtool.yaml | 11 +++++++++++ Documentation/networking/ethtool-netlink.rst | 26 ++++++++++++++++++++++= ++++ include/uapi/linux/ethtool_netlink_generated.h | 2 ++ net/ethtool/pse-pd.c | 18 ++++++++++++++++++ 4 files changed, 57 insertions(+) diff --git a/Documentation/netlink/specs/ethtool.yaml b/Documentation/netli= nk/specs/ethtool.yaml index 93e470895dc1..814aa54b35b5 100644 --- a/Documentation/netlink/specs/ethtool.yaml +++ b/Documentation/netlink/specs/ethtool.yaml @@ -1379,6 +1379,14 @@ attribute-sets: name: pse-pw-d-id type: u32 name-prefix: ethtool-a- + - + name: pse-prio-max + type: u32 + name-prefix: ethtool-a- + - + name: pse-prio + type: u32 + name-prefix: ethtool-a- - name: rss attr-cnt-name: __ethtool-a-rss-cnt @@ -2200,6 +2208,8 @@ operations: - c33-pse-avail-pw-limit - c33-pse-pw-limit-ranges - pse-pw-d-id + - pse-prio-max + - pse-prio dump: *pse-get-op - name: pse-set @@ -2214,6 +2224,7 @@ operations: - podl-pse-admin-control - c33-pse-admin-control - c33-pse-avail-pw-limit + - pse-prio - name: rss-get doc: Get RSS params. diff --git a/Documentation/networking/ethtool-netlink.rst b/Documentation/n= etworking/ethtool-netlink.rst index 49c9a0e79af5..efc410ae26c8 100644 --- a/Documentation/networking/ethtool-netlink.rst +++ b/Documentation/networking/ethtool-netlink.rst @@ -1790,6 +1790,10 @@ Kernel response contents: ``ETHTOOL_A_C33_PSE_PW_LIMIT_RANGES`` nested Supported power limit configuration ranges. ``ETHTOOL_A_PSE_PW_D_ID`` u32 Index of the PSE pow= er domain + ``ETHTOOL_A_PSE_PRIO_MAX`` u32 Priority maximum con= figurable + on the PoE PSE + ``ETHTOOL_A_PSE_PRIO`` u32 Priority of the PoE = PSE + currently configured =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D =3D=3D=3D=3D=3D=3D = =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D =20 When set, the optional ``ETHTOOL_A_PODL_PSE_ADMIN_STATE`` attribute identi= fies @@ -1866,6 +1870,12 @@ equal. The ``ETHTOOL_A_PSE_PW_D_ID`` attribute identifies the index of PSE power domain. =20 +When set, the optional ``ETHTOOL_A_PSE_PRIO_MAX`` attribute identifies +the PSE maximum priority value. +When set, the optional ``ETHTOOL_A_PSE_PRIO`` attributes is used to +identifies the currently configured PSE priority. +For a description of PSE priority attributes, see ``PSE_SET``. + PSE_SET =3D=3D=3D=3D=3D=3D=3D =20 @@ -1879,6 +1889,8 @@ Request contents: ``ETHTOOL_A_C33_PSE_ADMIN_CONTROL`` u32 Control PSE Admin state ``ETHTOOL_A_C33_PSE_AVAIL_PWR_LIMIT`` u32 Control PoE PSE available power limit + ``ETHTOOL_A_PSE_PRIO`` u32 Control priority of the + PoE PSE =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D =3D=3D=3D=3D=3D=3D =3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D =20 When set, the optional ``ETHTOOL_A_PODL_PSE_ADMIN_CONTROL`` attribute is u= sed @@ -1901,6 +1913,20 @@ various existing products that document power consum= ption in watts rather than classes. If power limit configuration based on classes is needed, the conversion can be done in user space, for example by ethtool. =20 +When set, the optional ``ETHTOOL_A_PSE_PRIO`` attributes is used to +control the PSE priority. Allowed priority value are between zero and +the value of ``ETHTOOL_A_PSE_PRIO_MAX`` attribute. + +A lower value indicates a higher priority, meaning that a priority value +of 0 corresponds to the highest port priority. +Port priority serves two functions: + + - Power-up Order: After a reset, ports are powered up in order of their + priority from highest to lowest. Ports with higher priority + (lower values) power up first. + - Shutdown Order: When the power budget is exceeded, ports with lower + priority (higher values) are turned off first. + PSE_NTF =3D=3D=3D=3D=3D=3D=3D =20 diff --git a/include/uapi/linux/ethtool_netlink_generated.h b/include/uapi/= linux/ethtool_netlink_generated.h index ccd7ab3bf1b1..0220cd83728a 100644 --- a/include/uapi/linux/ethtool_netlink_generated.h +++ b/include/uapi/linux/ethtool_netlink_generated.h @@ -634,6 +634,8 @@ enum { ETHTOOL_A_C33_PSE_AVAIL_PW_LIMIT, ETHTOOL_A_C33_PSE_PW_LIMIT_RANGES, ETHTOOL_A_PSE_PW_D_ID, + ETHTOOL_A_PSE_PRIO_MAX, + ETHTOOL_A_PSE_PRIO, =20 __ETHTOOL_A_PSE_CNT, ETHTOOL_A_PSE_MAX =3D (__ETHTOOL_A_PSE_CNT - 1) diff --git a/net/ethtool/pse-pd.c b/net/ethtool/pse-pd.c index f73d4fbe82e6..44dbff8c99f8 100644 --- a/net/ethtool/pse-pd.c +++ b/net/ethtool/pse-pd.c @@ -112,6 +112,9 @@ static int pse_reply_size(const struct ethnl_req_info *= req_base, len +=3D st->c33_pw_limit_nb_ranges * (nla_total_size(0) + nla_total_size(sizeof(u32)) * 2); + if (st->prio_max) + /* _PSE_PRIO_MAX + _PSE_PRIO */ + len +=3D nla_total_size(sizeof(u32)) * 2; =20 return len; } @@ -206,6 +209,11 @@ static int pse_fill_reply(struct sk_buff *skb, pse_put_pw_limit_ranges(skb, st)) return -EMSGSIZE; =20 + if (st->prio_max > 0 && + (nla_put_u32(skb, ETHTOOL_A_PSE_PRIO_MAX, st->prio_max) || + nla_put_u32(skb, ETHTOOL_A_PSE_PRIO, st->prio))) + return -EMSGSIZE; + return 0; } =20 @@ -227,6 +235,7 @@ const struct nla_policy ethnl_pse_set_policy[ETHTOOL_A_= PSE_MAX + 1] =3D { NLA_POLICY_RANGE(NLA_U32, ETHTOOL_C33_PSE_ADMIN_STATE_DISABLED, ETHTOOL_C33_PSE_ADMIN_STATE_ENABLED), [ETHTOOL_A_C33_PSE_AVAIL_PW_LIMIT] =3D { .type =3D NLA_U32 }, + [ETHTOOL_A_PSE_PRIO] =3D { .type =3D NLA_U32 }, }; =20 static int @@ -275,6 +284,15 @@ ethnl_set_pse(struct ethnl_req_info *req_info, struct = genl_info *info) if (ret) return ret; =20 + if (tb[ETHTOOL_A_PSE_PRIO]) { + unsigned int prio; + + prio =3D nla_get_u32(tb[ETHTOOL_A_PSE_PRIO]); + ret =3D pse_ethtool_set_prio(phydev->psec, info->extack, prio); + if (ret) + return ret; + } + if (tb[ETHTOOL_A_C33_PSE_AVAIL_PW_LIMIT]) { unsigned int pw_limit; =20 --=20 2.34.1