From nobody Mon Feb 9 14:32:01 2026 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 46B58C41513 for ; Fri, 4 Aug 2023 21:26:20 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S230008AbjHDV0S (ORCPT ); Fri, 4 Aug 2023 17:26:18 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:44040 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230422AbjHDV0K (ORCPT ); Fri, 4 Aug 2023 17:26:10 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 751A2E60; Fri, 4 Aug 2023 14:26:08 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 3627b7821fbcc242; Fri, 4 Aug 2023 23:26:06 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 4E705661680; Fri, 4 Aug 2023 23:26:06 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI , Daniel Lezcano Cc: LKML , Linux PM , Michal Wilczynski , Zhang Rui , Srinivas Pandruvada Subject: [PATCH v4 07/10] ACPI: thermal: Use trip point table to register thermal zones Date: Fri, 04 Aug 2023 23:18:10 +0200 Message-ID: <1987843.usQuhbGJ8B@kreacher> In-Reply-To: <4878513.31r3eYUQgx@kreacher> References: <13318886.uLZWGnKmhe@kreacher> <4878513.31r3eYUQgx@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrkeeggdduheelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepmhhitghhrghlrdifihhltgiihihnshhkihesihhnthgvlhdrtghomhdprhgtphhtthhopehruhhirdiihhgrnhhgsehinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki Make the ACPI thermal driver use thermal_zone_device_register_with_trips() to register its thermal zones. For this purpose, make it create a trip point table that will be passed to thermal_zone_device_register_with_trips() as an argument. Also use the thermal_zone_update_trip_temp() helper introduced previously to update temperatures of the passive and active trip points after a trip points change notification from the platform firmware. Signed-off-by: Rafael J. Wysocki --- v3 -> v4: * Rework to use thermal_zone_update_trip_temp() for updating trip point temperatures. * Rebase on top of the new version of the previous patch. v2 -> v3: * Fix error code path memory leak in acpi_thermal_register_thermal_zone(= ). * Notice that the critical and hot trips never change after initializati= on, so don't add struct thermal_trip_ref to any of them. v1 -> v2: * Use thermal_zone_device_lock()/thermal_zone_device_unlock() in acpi_thermal_check_fn() explicitly and call __thermal_zone_device_upda= te() from there without unlocking the thermal zone. * Export __thermal_zone_device_update() to modules (so it can be called = by the ACPI thermal code). --- drivers/acpi/thermal.c | 95 ++++++++++++++++++++++++++++++++++++++++++++= ----- 1 file changed, 87 insertions(+), 8 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -137,6 +137,7 @@ struct acpi_thermal { unsigned long polling_frequency; volatile u8 zombie; struct acpi_thermal_trips trips; + struct thermal_trip *trip_table; struct acpi_handle_list devices; struct thermal_zone_device *thermal_zone; int kelvin_offset; /* in millidegrees */ @@ -190,6 +191,22 @@ static int acpi_thermal_get_polling_freq return 0; } =20 +static int acpi_thermal_temp(struct acpi_thermal *tz, int temp_deci_k) +{ + if (temp_deci_k =3D=3D THERMAL_TEMP_INVALID) + return THERMAL_TEMP_INVALID; + + return deci_kelvin_to_millicelsius_with_offset(temp_deci_k, + tz->kelvin_offset); +} + +static void acpi_thermal_update_trip_temp(struct acpi_thermal *tz, + void *trip_priv, int temp_deci_k) +{ + thermal_zone_update_trip_temp(tz->thermal_zone, trip_priv, + acpi_thermal_temp(tz, temp_deci_k)); +} + static void __acpi_thermal_trips_update(struct acpi_thermal *tz, int flag) { acpi_status status; @@ -403,7 +420,28 @@ static void __acpi_thermal_trips_update( static void acpi_thermal_adjust_thermal_zone(struct thermal_zone_device *t= hermal, unsigned long data) { - __acpi_thermal_trips_update(thermal_zone_device_priv(thermal), data); + struct acpi_thermal *tz =3D thermal_zone_device_priv(thermal); + int i; + + __acpi_thermal_trips_update(tz, data); + + if (tz->trips.passive.valid) + acpi_thermal_update_trip_temp(tz, &tz->trips.passive, + tz->trips.passive.temperature); + else + thermal_zone_update_trip_temp(tz->thermal_zone, + &tz->trips.passive, + THERMAL_TEMP_INVALID); + + for (i =3D 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { + if (tz->trips.active[i].valid) + acpi_thermal_update_trip_temp(tz, &tz->trips.active[i], + tz->trips.active[i].temperature); + else + thermal_zone_update_trip_temp(tz->thermal_zone, + &tz->trips.active[i], + THERMAL_TEMP_INVALID); + } } =20 static void acpi_queue_thermal_check(struct acpi_thermal *tz) @@ -768,6 +806,7 @@ static void acpi_thermal_zone_sysfs_remo =20 static int acpi_thermal_register_thermal_zone(struct acpi_thermal *tz) { + struct thermal_trip *trip; int passive_delay =3D 0; int trip_count =3D 0; int result; @@ -788,12 +827,50 @@ static int acpi_thermal_register_thermal for (i =3D 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].valid; i= ++) trip_count++; =20 - tz->thermal_zone =3D thermal_zone_device_register("acpitz", trip_count, 0, - tz, &acpi_thermal_zone_ops, - NULL, passive_delay, - tz->polling_frequency * 100); - if (IS_ERR(tz->thermal_zone)) - return -ENODEV; + trip =3D kcalloc(trip_count, sizeof(*trip), GFP_KERNEL); + if (!trip) + return -ENOMEM; + + tz->trip_table =3D trip; + + if (tz->trips.critical.valid) { + trip->type =3D THERMAL_TRIP_CRITICAL; + trip->temperature =3D acpi_thermal_temp(tz, tz->trips.critical.temperatu= re); + trip++; + } + + if (tz->trips.hot.valid) { + trip->type =3D THERMAL_TRIP_HOT; + trip->temperature =3D acpi_thermal_temp(tz, tz->trips.hot.temperature); + trip++; + } + + if (tz->trips.passive.valid) { + trip->type =3D THERMAL_TRIP_PASSIVE; + trip->temperature =3D acpi_thermal_temp(tz, tz->trips.passive.temperatur= e); + trip->priv =3D &tz->trips.passive; + trip++; + } + + for (i =3D 0; i < ACPI_THERMAL_MAX_ACTIVE && tz->trips.active[i].valid; i= ++) { + trip->type =3D THERMAL_TRIP_ACTIVE; + trip->temperature =3D acpi_thermal_temp(tz, tz->trips.active[i].temperat= ure); + trip->priv =3D &tz->trips.active[i]; + trip++; + } + + tz->thermal_zone =3D thermal_zone_device_register_with_trips("acpitz", + tz->trip_table, + trip_count, + 0, tz, + &acpi_thermal_zone_ops, + NULL, + passive_delay, + tz->polling_frequency * 100); + if (IS_ERR(tz->thermal_zone)) { + result =3D PTR_ERR(tz->thermal_zone); + goto free_trip_table; + } =20 result =3D acpi_thermal_zone_sysfs_add(tz); if (result) @@ -821,6 +898,8 @@ remove_links: acpi_thermal_zone_sysfs_remove(tz); unregister_tzd: thermal_zone_device_unregister(tz->thermal_zone); +free_trip_table: + kfree(tz->trip_table); =20 return result; } @@ -829,6 +908,7 @@ static void acpi_thermal_unregister_ther { acpi_thermal_zone_sysfs_remove(tz); thermal_zone_device_unregister(tz->thermal_zone); + kfree(tz->trip_table); tz->thermal_zone =3D NULL; acpi_bus_detach_private_data(tz->device->handle); }