From nobody Wed Sep 10 09:29:27 2025 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 41B24C04A94 for ; Tue, 1 Aug 2023 19:41:19 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S232564AbjHATlS (ORCPT ); Tue, 1 Aug 2023 15:41:18 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:32900 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229802AbjHATlQ (ORCPT ); Tue, 1 Aug 2023 15:41:16 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 2E60819AA; Tue, 1 Aug 2023 12:41:13 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id c9b1b73f48a619ce; Tue, 1 Aug 2023 21:41:11 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id B001E6621DD; Tue, 1 Aug 2023 21:41:10 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM , Peter Zijlstra , Anna-Maria Behnsen Cc: LKML , Frederic Weisbecker , Kajetan Puchalski Subject: [RFC/RFT][PATCH v1 2/2] cpuidle: teo: Skip tick_nohz_get_sleep_length() call in some cases Date: Tue, 01 Aug 2023 21:40:31 +0200 Message-ID: <13328817.uLZWGnKmhe@kreacher> In-Reply-To: <4511619.LvFx2qVVIh@kreacher> References: <4511619.LvFx2qVVIh@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrjeeigddufeeiucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepiedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehpvghtvghriiesihhnfhhrrgguvggrugdrohhrghdprhgtphhtthhopegrnhhnrgdqmhgrrhhirgeslhhinhhuthhrohhnihigrdguvgdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehfrhgv uggvrhhitgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepkhgrjhgvthgrnhdrphhutghhrghlshhkihesrghrmhdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki Make teo_select() avoid calling tick_nohz_get_sleep_length() if the candidate idle state to return is state 0 or if state 0 is a polling one and the target residency of the current candidate one is below a certain threshold, in which cases it may be assumed that the CPU will be woken up immediately by a non-timer wakeup source and the timers are not likely to matter. Signed-off-by: Rafael J. Wysocki --- drivers/cpuidle/governors/teo.c | 22 ++++++++++++++++++++++ 1 file changed, 22 insertions(+) Index: linux-pm/drivers/cpuidle/governors/teo.c =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D --- linux-pm.orig/drivers/cpuidle/governors/teo.c +++ linux-pm/drivers/cpuidle/governors/teo.c @@ -166,6 +166,12 @@ */ #define NR_RECENT 9 =20 +/* + * Idle state target residency threshold used for deciding whether or not = to + * check the time till the closest expected timer event. + */ +#define RESIDENCY_THRESHOLD_NS (15 * NSEC_PER_USEC) + /** * struct teo_bin - Metrics used by the TEO cpuidle governor. * @intercepts: The "intercepts" metric. @@ -543,6 +549,22 @@ static int teo_select(struct cpuidle_dri idx =3D i; } =20 + /* + * Skip the timers check if state 0 is the current candidate one, + * because an immediate non-timer wakeup is expected in that case. + */ + if (!idx) + goto out_tick; + + /* + * If state 0 is a polling one, check if the target residency of + * the current candidate state is low enough and skip the timers + * check in that case too. + */ + if ((drv->states[0].flags & CPUIDLE_FLAG_POLLING) && + drv->states[idx].target_residency_ns < RESIDENCY_THRESHOLD_NS) + goto out_tick; + duration_ns =3D tick_nohz_get_sleep_length(&delta_tick); cpu_data->sleep_length_ns =3D duration_ns;