From nobody Tue Feb 10 00:22:17 2026 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id E4CA01E1A16; Tue, 28 Jan 2025 19:24:51 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=79.96.170.134 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1738092294; cv=none; b=ECxaEcNLoy8xeFLBkZViPqX8UTN/GjYd+RTD4a3MZpNqGnz2N9ZHksM9T8LdlczDJV8PsePRdcgM+OLCSlIRyUzk9zl17hP/4w0QGcN/ITDO+h/Y/iAuJ/8NHBauEU7UWjkN9dhF3HKdyxTEazJSOi65Txbya+SmxAMgXnL4cNg= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1738092294; c=relaxed/simple; bh=0/zwL7RIh3wh/UroJ77L3c3Pm+GTkDsiRNFuxhryXo8=; h=From:To:Cc:Subject:Date:Message-ID:MIME-Version:Content-Type; b=ZXRDGcEw4qS2uI2e9cQv/ozJRgWCKtUY8LiJepw1Gw15Csf6WUIYLP9HOfY3HSEoegUTN3Z/YPMWU3J8o8dNQY+zrquzxdZNDWkzXfR/c1J0d4w0eGg7uABC4yGFoq68futFobtIO75V/1pFoRUKNQCgWxTE/ty5tkrbi/qx+4s= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net; spf=pass smtp.mailfrom=rjwysocki.net; dkim=pass (2048-bit key) header.d=rjwysocki.net header.i=@rjwysocki.net header.b=BRQeWsY1; arc=none smtp.client-ip=79.96.170.134 Authentication-Results: smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=rjwysocki.net Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=rjwysocki.net header.i=@rjwysocki.net header.b="BRQeWsY1" Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 6.2.1) id ae53d34fe11408ef; Tue, 28 Jan 2025 20:24:43 +0100 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by cloudserver094114.home.pl (Postfix) with ESMTPSA id 253EB8A2CB3; Tue, 28 Jan 2025 20:24:42 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=rjwysocki.net; s=dkim; t=1738092283; bh=0/zwL7RIh3wh/UroJ77L3c3Pm+GTkDsiRNFuxhryXo8=; h=From:Subject:Date; b=BRQeWsY1mVefj8qwg8ylVXqsKHdSrI2zogJ1ARFYsO6aeKiJLnCYJS9li9Y+Adc0L oYZRl3ua5kn+Snrazz98a+Q30ARBJovRW8Req/4PSo1Z1h2xeFep0iPM2iaeKTTcNY SSDUlrshb2tBnr9DxenhHITxwOjQ8UafUwZoiKUFNdOPoI8uqz0tf1AJq7N+3tRKkT ZIOsJOeFVW1zvj3DGu69A3B6UKTOYbNovMLT3WvqzEd8r8FRivc/ZIox+osp5XsVkh SiaofaDppG72IKHtxhP9SgX0z1NTO1SLSMA23GBwyevnKc3EVxNhUGoMrbz0ZHxlC1 i7ygEJdLeHbRA== From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Alan Stern , Bjorn Helgaas , Linux PCI , Ulf Hansson , Johan Hovold , Manivannan Sadhasivam , Kevin Xie Subject: [PATCH v1] PM: sleep: core: Synchronize runtime PM status of parents and children Date: Tue, 28 Jan 2025 20:24:41 +0100 Message-ID: <12619233.O9o76ZdvQC@rjwysocki.net> Precedence: bulk X-Mailing-List: linux-kernel@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeefvddrtddtgdelgecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpeegfffhudejlefhtdegffekteduhfethffhieettefhkeevgfdvgfefieekiefgheenucffohhmrghinhepkhgvrhhnvghlrdhorhhgnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomheprhhjfiesrhhjfiihshhotghkihdrnhgvthdpnhgspghrtghpthhtohepledprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehsthgvrhhnsehrohiflhgrnhgurdhhrghrvhgrrhgurdgvughupdhrtghpthhtohephhgvlhhgrggrsheskhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphgtihe X-DCC--Metrics: v370.home.net.pl 1024; Body=9 Fuz1=9 Fuz2=9 Content-Type: text/plain; charset="utf-8" From: Rafael J. Wysocki Commit 6e176bf8d461 ("PM: sleep: core: Do not skip callbacks in the resume phase") overlooked the case in which the parent of a device with DPM_FLAG_SMART_SUSPEND set did not use that flag and could be runtime- suspended before a transition into a system-wide sleep state. In that case, if the child is resumed during the subsequent transition from that state into the working state, its runtime PM status will be set to RPM_ACTIVE, but the runtime PM status of the parent will not be updated accordingly, even though the parent will be resumed too, because of the dev_pm_skip_suspend() check in device_resume_noirq(). Address this problem by tracking the need to set the runtime PM status to RPM_ACTIVE during system-wide resume transitions for devices with DPM_FLAG_SMART_SUSPEND set and all of the devices depended on by them. Fixes: 6e176bf8d461 ("PM: sleep: core: Do not skip callbacks in the resume = phase") Closes: https://lore.kernel.org/linux-pm/Z30p2Etwf3F2AUvD@hovoldconsulting.= com/ Reported-by: Johan Hovold Tested-by: Manivannan Sadhasivam Signed-off-by: Rafael J. Wysocki Reviewed-by: Johan Hovold Tested-by: Johan Hovold --- drivers/base/power/main.c | 29 ++++++++++++++++++++--------- include/linux/pm.h | 1 + 2 files changed, 21 insertions(+), 9 deletions(-) --- a/drivers/base/power/main.c +++ b/drivers/base/power/main.c @@ -656,13 +656,15 @@ * so change its status accordingly. * * Otherwise, the device is going to be resumed, so set its PM-runtime - * status to "active", but do that only if DPM_FLAG_SMART_SUSPEND is set - * to avoid confusing drivers that don't use it. + * status to "active" unless its power.set_active flag is clear, in + * which case it is not necessary to update its PM-runtime status. */ - if (skip_resume) + if (skip_resume) { pm_runtime_set_suspended(dev); - else if (dev_pm_skip_suspend(dev)) + } else if (dev->power.set_active) { pm_runtime_set_active(dev); + dev->power.set_active =3D false; + } =20 if (dev->pm_domain) { info =3D "noirq power domain "; @@ -1189,18 +1191,24 @@ return PMSG_ON; } =20 -static void dpm_superior_set_must_resume(struct device *dev) +static void dpm_superior_set_must_resume(struct device *dev, bool set_acti= ve) { struct device_link *link; int idx; =20 - if (dev->parent) + if (dev->parent) { dev->parent->power.must_resume =3D true; + if (set_active) + dev->parent->power.set_active =3D true; + } =20 idx =3D device_links_read_lock(); =20 - list_for_each_entry_rcu_locked(link, &dev->links.suppliers, c_node) + list_for_each_entry_rcu_locked(link, &dev->links.suppliers, c_node) { link->supplier->power.must_resume =3D true; + if (set_active) + link->supplier->power.set_active =3D true; + } =20 device_links_read_unlock(idx); } @@ -1278,8 +1286,11 @@ dev->power.may_skip_resume)) dev->power.must_resume =3D true; =20 - if (dev->power.must_resume) - dpm_superior_set_must_resume(dev); + if (dev->power.must_resume) { + dev->power.set_active =3D dev->power.set_active || + dev_pm_test_driver_flags(dev, DPM_FLAG_SMART_SUSPEND); + dpm_superior_set_must_resume(dev, dev->power.set_active); + } =20 Complete: complete_all(&dev->power.completion); --- a/include/linux/pm.h +++ b/include/linux/pm.h @@ -683,6 +683,7 @@ bool no_pm_callbacks:1; /* Owned by the PM core */ bool async_in_progress:1; /* Owned by the PM core */ bool must_resume:1; /* Owned by the PM core */ + bool set_active:1; /* Owned by the PM core */ bool may_skip_resume:1; /* Set by subsystems */ #else bool should_wakeup:1;