From nobody Tue Feb 10 21:45:17 2026 Delivered-To: importer@patchew.org Received-SPF: pass (zohomail.com: domain of lists.xenproject.org designates 192.237.175.120 as permitted sender) client-ip=192.237.175.120; envelope-from=xen-devel-bounces@lists.xenproject.org; helo=lists.xenproject.org; Authentication-Results: mx.zohomail.com; spf=pass (zohomail.com: domain of lists.xenproject.org designates 192.237.175.120 as permitted sender) smtp.mailfrom=xen-devel-bounces@lists.xenproject.org; dmarc=fail(p=quarantine dis=quarantine) header.from=epam.com Return-Path: Received: from lists.xenproject.org (lists.xenproject.org [192.237.175.120]) by mx.zohomail.com with SMTPS id 1735540317987839.9086573370145; Sun, 29 Dec 2024 22:31:57 -0800 (PST) Received: from list by lists.xenproject.org with outflank-mailman.863498.1274877 (Exim 4.92) (envelope-from ) id 1tS9It-0003Py-Gi; Mon, 30 Dec 2024 06:31:03 +0000 Received: by outflank-mailman (output) from mailman id 863498.1274877; Mon, 30 Dec 2024 06:31:03 +0000 Received: from localhost ([127.0.0.1] helo=lists.xenproject.org) by lists.xenproject.org with esmtp (Exim 4.92) (envelope-from ) id 1tS9It-0003Pg-A5; Mon, 30 Dec 2024 06:31:03 +0000 Received: by outflank-mailman (input) for mailman id 863498; Mon, 30 Dec 2024 06:31:02 +0000 Received: from se1-gles-flk1-in.inumbo.com ([94.247.172.50] helo=se1-gles-flk1.inumbo.com) by lists.xenproject.org with esmtp (Exim 4.92) (envelope-from ) id 1tS9Is-0003PY-Ak for xen-devel@lists.xenproject.org; Mon, 30 Dec 2024 06:31:02 +0000 Received: from fforwardh-b1-smtp.messagingengine.com (fforwardh-b1-smtp.messagingengine.com [202.12.124.196]) by se1-gles-flk1.inumbo.com (Halon) with ESMTPS id a13c5401-c677-11ef-99a4-01e77a169b0f; Mon, 30 Dec 2024 07:30:59 +0100 (CET) Received: from phl-compute-03.internal (phl-compute-03.phl.internal [10.202.2.43]) by mailfforwardh.stl.internal (Postfix) with ESMTP id 34C6D1740216; Mon, 30 Dec 2024 01:30:57 -0500 (EST) Received: from phl-frontend-01 ([10.202.2.160]) by phl-compute-03.internal (MEProxy); Mon, 30 Dec 2024 01:30:57 -0500 Received: by mail.messagingengine.com (Postfix) with ESMTPA; Mon, 30 Dec 2024 01:30:55 -0500 (EST) X-Outflank-Mailman: Message body and most headers restored to incoming version X-BeenThere: xen-devel@lists.xenproject.org List-Id: Xen developer discussion List-Unsubscribe: , List-Post: List-Help: List-Subscribe: , Errors-To: xen-devel-bounces@lists.xenproject.org Precedence: list Sender: "Xen-devel" X-Inumbo-ID: a13c5401-c677-11ef-99a4-01e77a169b0f DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:date:date:feedback-id:feedback-id:from:from :in-reply-to:message-id:mime-version:reply-to:subject:subject:to :to:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm2; t= 1735540257; x=1735626657; bh=47jPvvLrAreNHOM7qNJpTbX/D3BrAJfjIZq o8xSBXtM=; b=OPtTCuxm5oHeN1+Tu4tCmEn4yWG9YooqkUqK5J2nfvceb4vA8Jm up5xP1rYU9w2e3tcGbfRFBSpspa6kt5lPWFP1UJmeMYy14gDeGbU0M/bJ/l4zpC/ 0e/4XYc2xkwFi3vKgs30UDDZoE11QYFhJaosdDWDenHzFSX/0k1tqn01dsheFbfc vUauj3T+IM3lEjlREaNImlg9331XsZDUYLpGigaKaayFYAwnmJW/Gskp46+a9Mj5 NQ37WlGt8dDHUldXqs4129aLzM/GXHI5XgDS5OlQYsWDAbLwgBNjsT3NMWAZvrjs dg9Oth9P3UbQN2l9Wgmo86kDu15qka5eUHA== X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefuddruddvhedgleehucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhephffvvefufffkofgggfestdekredtredttdenucfh rhhomhepufgvrhhgihihucfmihgsrhhikhcuoefuvghrghhihigpmfhisghrihhksegvph grmhdrtghomheqnecuggftrfgrthhtvghrnhepffffvdeifeeijefhheefuedvvedtheff jeeiveehgfettedvgedujefgudejgedvnecuvehluhhsthgvrhfuihiivgeptdenucfrrg hrrghmpehmrghilhhfrhhomhepshgrkhhisgesuggrrhhkshhtrghrrdhsihhtvgdpnhgs pghrtghpthhtohepudehpdhmohguvgepshhmthhpohhuthdprhgtphhtthhopeigvghnqd guvghvvghlsehlihhsthhsrdigvghnphhrohhjvggtthdrohhrghdprhgtphhtthhopehs thgvfhgrnhhordhsthgrsggvlhhlihhnihesrghmugdrtghomhdprhgtphhtthhopehssh htrggsvghllhhinhhisehkvghrnhgvlhdrohhrghdprhgtphhtthhopehjuhhlihgvnhes gigvnhdrohhrghdprhgtphhtthhopegsvghrthhrrghnugdrmhgrrhhquhhishesrghrmh drtghomhdprhgtphhtthhopehmihgthhgrlhdrohhriigvlhesrghmugdrtghomhdprhgt phhtthhopehvohhlohguhihmhihrpggsrggstghhuhhksegvphgrmhdrtghomhdprhgtph htthhopegrnhgurhgvfidrtghoohhpvghrfeestghithhrihigrdgtohhmpdhrtghpthht oheprghnthhhohhnhidrphgvrhgrrhgusehvrghtvghsrdhtvggthh X-ME-Proxy: Feedback-ID: if569265f:Fastmail From: Sergiy Kibrik To: xen-devel@lists.xenproject.org Cc: Stefano Stabellini , Stefano Stabellini , Julien Grall , Bertrand Marquis , Michal Orzel , Volodymyr Babchuk , Andrew Cooper , Anthony PERARD , Jan Beulich , =?UTF-8?q?Roger=20Pau=20Monn=C3=A9?= , Tamas K Lengyel , Alexandru Isaila , Petre Pircalabu , Sergiy Kibrik Subject: [XEN PATCH v1] xen: mem_access: conditionally compile vm_event.c & monitor.c Date: Mon, 30 Dec 2024 08:30:51 +0200 Message-Id: <20241230063051.3332332-1-Sergiy_Kibrik@epam.com> X-Mailer: git-send-email 2.25.1 MIME-Version: 1.0 Content-Transfer-Encoding: quoted-printable X-ZM-MESSAGEID: 1735540319803116600 Content-Type: text/plain; charset="utf-8" From: Stefano Stabellini Extend coverage of CONFIG_MEM_ACCESS option and make the build of VM events and monitoring support optional. This is to reduce code size on Arm when this option isn't enabled. Signed-off-by: Stefano Stabellini Signed-off-by: Sergiy Kibrik Reviewed-by: Ayan Kumar Halder --- xen/arch/arm/Makefile | 4 ++-- xen/arch/arm/vsmc.c | 3 ++- xen/common/Makefile | 4 ++-- xen/include/xen/monitor.h | 9 +++++++++ xen/include/xen/vm_event.h | 14 +++++++++++--- 5 files changed, 26 insertions(+), 8 deletions(-) diff --git a/xen/arch/arm/Makefile b/xen/arch/arm/Makefile index 43ab5e8f25..8903eb0bf2 100644 --- a/xen/arch/arm/Makefile +++ b/xen/arch/arm/Makefile @@ -39,7 +39,7 @@ obj-$(CONFIG_LIVEPATCH) +=3D livepatch.o obj-$(CONFIG_LLC_COLORING) +=3D llc-coloring.o obj-$(CONFIG_MEM_ACCESS) +=3D mem_access.o obj-y +=3D mm.o -obj-y +=3D monitor.o +obj-$(CONFIG_MEM_ACCESS) +=3D monitor.o obj-y +=3D p2m.o obj-y +=3D platform.o obj-y +=3D platform_hypercall.o @@ -65,7 +65,7 @@ obj-$(CONFIG_VGICV2) +=3D vgic-v2.o obj-$(CONFIG_GICV3) +=3D vgic-v3.o obj-$(CONFIG_HAS_ITS) +=3D vgic-v3-its.o endif -obj-y +=3D vm_event.o +obj-$(CONFIG_MEM_ACCESS) +=3D vm_event.o obj-y +=3D vtimer.o obj-$(CONFIG_SBSA_VUART_CONSOLE) +=3D vpl011.o obj-y +=3D vsmc.o diff --git a/xen/arch/arm/vsmc.c b/xen/arch/arm/vsmc.c index 62d8117a12..1c13326bdf 100644 --- a/xen/arch/arm/vsmc.c +++ b/xen/arch/arm/vsmc.c @@ -330,7 +330,8 @@ void do_trap_smc(struct cpu_user_regs *regs, const unio= n hsr hsr) } =20 /* If monitor is enabled, let it handle the call. */ - if ( current->domain->arch.monitor.privileged_call_enabled ) + if ( IS_ENABLED(CONFIG_MEM_ACCESS) && + current->domain->arch.monitor.privileged_call_enabled ) rc =3D monitor_smc(); =20 if ( rc =3D=3D 1 ) diff --git a/xen/common/Makefile b/xen/common/Makefile index cba3b32733..e3c6a857ab 100644 --- a/xen/common/Makefile +++ b/xen/common/Makefile @@ -54,7 +54,7 @@ obj-y +=3D timer.o obj-$(CONFIG_TRACEBUFFER) +=3D trace.o obj-y +=3D version.o obj-y +=3D virtual_region.o -obj-y +=3D vm_event.o +obj-$(CONFIG_MEM_ACCESS) +=3D vm_event.o obj-$(CONFIG_HAS_VMAP) +=3D vmap.o obj-y +=3D vsprintf.o obj-y +=3D wait.o @@ -68,7 +68,7 @@ obj-$(CONFIG_COMPAT) +=3D $(addprefix compat/,domain.o me= mory.o multicall.o xlat.o =20 ifneq ($(CONFIG_PV_SHIM_EXCLUSIVE),y) obj-y +=3D domctl.o -obj-y +=3D monitor.o +obj-$(CONFIG_MEM_ACCESS) +=3D monitor.o obj-y +=3D sysctl.o endif =20 diff --git a/xen/include/xen/monitor.h b/xen/include/xen/monitor.h index 713d54f7c1..f1359abb94 100644 --- a/xen/include/xen/monitor.h +++ b/xen/include/xen/monitor.h @@ -27,8 +27,17 @@ struct domain; struct xen_domctl_monitor_op; =20 +#ifdef CONFIG_MEM_ACCESS int monitor_domctl(struct domain *d, struct xen_domctl_monitor_op *mop); void monitor_guest_request(void); +#else +static inline int monitor_domctl(struct domain *d, + struct xen_domctl_monitor_op *mop) +{ + return -EINVAL; +} +static inline void monitor_guest_request(void) {} +#endif =20 int monitor_traps(struct vcpu *v, bool sync, vm_event_request_t *req); =20 diff --git a/xen/include/xen/vm_event.h b/xen/include/xen/vm_event.h index 9a86358b42..72e720e378 100644 --- a/xen/include/xen/vm_event.h +++ b/xen/include/xen/vm_event.h @@ -50,9 +50,6 @@ struct vm_event_domain unsigned int last_vcpu_wake_up; }; =20 -/* Clean up on domain destruction */ -void vm_event_cleanup(struct domain *d); - /* Returns whether a ring has been set up */ bool vm_event_check_ring(struct vm_event_domain *ved); =20 @@ -88,7 +85,18 @@ void vm_event_cancel_slot(struct domain *d, struct vm_ev= ent_domain *ved); void vm_event_put_request(struct domain *d, struct vm_event_domain *ved, vm_event_request_t *req); =20 +#ifdef CONFIG_MEM_ACCESS +/* Clean up on domain destruction */ +void vm_event_cleanup(struct domain *d); int vm_event_domctl(struct domain *d, struct xen_domctl_vm_event_op *vec); +#else +static inline void vm_event_cleanup(struct domain *d) {} +static inline int vm_event_domctl(struct domain *d, + struct xen_domctl_vm_event_op *vec) +{ + return -EINVAL; +} +#endif =20 void vm_event_vcpu_pause(struct vcpu *v); void vm_event_vcpu_unpause(struct vcpu *v); --=20 2.25.1